KEGG   Dehalococcoides mccartyi CG1: X792_03060Help
Entry
X792_03060        CDS       T03647                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dmx  Dehalococcoides mccartyi CG1
Pathway
dmx00550  Peptidoglycan biosynthesis
dmx01100  Metabolic pathways
dmx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dmx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    X792_03060
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X792_03060
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    X792_03060
Enzymes [BR:dmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     X792_03060
Peptidoglycan biosynthesis and degradation proteins [BR:dmx01011]
 Precursor biosynthesis
  Amino acid ligase
   X792_03060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C GARS_A CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATP-grasp RimK TTL
Motif
Other DBs
NCBI-ProteinID: AII57767
UniProt: A0A076IA97
LinkDB All DBs
Position
565931..566947
Genome map
AA seq 338 aa AA seqDB search
MQIGLSYDLKQALKPVAGGPDDALEEYDSPETVEAITTALKAAGHTVYRLGGGKEFLRRV
QEQKLDLVFNISEGLGNYRSREAQIPSILEMLDIPYTGSDPQTLAICLDKPLTKKLVASA
GIKTARWQLVNNCEELSAIDWSGFPLPAFLKPACEGSSKGVRFASRAESIDEIMSMAADL
LTTYEQPVLIEEFINGEEITVGVIGNTSPEVLGIMRVVPKTKTDYFVYSIEVKRNWRQMV
EYEVPAALPGETLARIEKATLDAYKVLECRDLCRMDFRISPDGVPYFLEVNPLPGLNPVS
GDLPIMVSKLGISHAELVLKILNTAMVRHNLLAENCLL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatagggctgtcatacgatcttaaacaggcattaaaaccggttgccggcggccct
gatgatgcgttggaagaatatgactcaccggaaacggtagaggctataacaaccgccttg
aaggcagcgggtcataccgtttaccgcttgggcgggggcaaagaatttttacgcagggtg
caggaacagaaacttgaccttgttttcaatatttccgaagggttgggtaattaccgcagc
cgcgaagctcaaatccccagtattttagagatgttagatataccttacacaggttcagat
ccgcagacacttgcaatctgtctggacaaacctctcaccaagaaactggtagccagtgca
ggtataaagactgccagatggcaattggtaaacaactgtgaagagctttctgctatagac
tggtcgggatttccattgccggcttttttgaagcccgcctgtgaggggtcaagcaagggt
gtaaggtttgcttcacgtgccgaaagtattgacgagataatgagtatggctgcggatctg
ctgactacctatgagcagcctgttttaatagaagaatttataaacggtgaagagattaca
gtaggggttataggcaacacctcccccgaggttttgggtataatgcgggttgtgcctaaa
actaagactgattattttgtttactctatagaggttaagcgcaactggcggcagatggtg
gaatatgaagttccggcggctttacccggggaaactctggcgcggattgaaaaagccacc
ttggatgcgtataaagtattggaatgtcgtgacctgtgccgtatggatttcagaataagc
cctgacggcgtgccgtattttctggaggtaaacccgttgcccggtcttaaccctgtcagc
ggggatttgccgattatggtatctaaattgggtatcagccatgcagagttggtgttaaaa
atacttaacacggcaatggttcgccacaatctgttagcggagaactgcctgctctaa

DBGET integrated database retrieval system