Diuraphis noxia (Russian wheat aphid): 107170179 Help Entry 107170179         CDS       T04900                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism dnx  Diuraphis noxia (Russian wheat aphid) Brite KEGG Orthology (KO) [BR:dnx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dnx03036]     107170179   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dnx04147]     107170179 Chromosome and associated proteins [BR:dnx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107170179 Exosome [BR:dnx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107170179 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  107170179 NCBI-ProteinID:  XP_015375714 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search KNIAKSDKKRKPKRKESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDLFERIAAESSR LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 321 nt NT seq  +upstreamnt  +downstreamnt aagaacatcgccaagtccgacaagaaacgcaagccaaagaggaaagagtcgtacgccatc tacatttacaaagtgttgaaacaagtgcatcccgataccggtgtctcgtcgaaagcmatg agcatcatgaacagtttcgtcaacgatctgttcgagcgcatcgccgccgaatctagtcgc ctggcycactacaacaagcgttcgaccattactagycgggaaattcagaccgccgtccgc ctcttgttgcccggtgaattggccaaacacgccgtcagtgaaggaactaaggctgttacc aagtacaccagctccaagtag

DBGET integrated database retrieval system