KEGG   Donghicola sp. JLT3646: BSK21_11470Help
Entry
BSK21_11470       CDS       T04589                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
don  Donghicola sp. JLT3646
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:don00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSK21_11470
  Amino acid metabolism
   00310 Lysine degradation
    BSK21_11470
   00380 Tryptophan metabolism
    BSK21_11470
Enzymes [BR:don01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BSK21_11470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2301456..2304425
Genome map
AA seq 989 aa AA seqDB search
MNDQSPNDVFHASSFLQGHNAEYIEQLYARYADNPNAVDESWRDFFASLGDTPSEAKAEA
AGASWTRHDWPPVPNDDLTAALDGQWPADAKAAGDKIKAKAAEKGASISEEQVRLAVLDS
IRALMIIRAYRIRGHLIADLDPLGMRDTVPHPELDPKSYGFTPADMDRPIFIDNVLGLEV
ATMNEIMAIVRRTYCGTFALQYMHISDPEQAGWLKERIEGFGKEITFTQNGRKAILNKLV
EAEGFEKFLHVKYMGTKRFGLDGGESLIPAMEQIIKRGGALGVKEIVIGMPHRGRLSVLA
NVMSKPYRAIFNEFQGGSFKPEDVDGSGDVKYHLGASSDRSFDGNEVHLSLTANPSHLEA
VNPVVLGKARAKTDQMNDQTRHSVLPILLHGDAAFAGQGVVAECFALSGLRGHRTGGTIH
IVVNNQIGFTTAPHFSRSSPYPTDNALVVEAPIFHVNGDDPEAVVHAAKVATEFRQKFHK
DVVIDIFCYRRFGHNEGDEPMFTNPAMYNRIKKHKTTLQLYTERLVKDGLIPEGEIEDMK
AQFQALLNEEFEAGREYKPNKADWLDGRWSHMDRQKQGKYQRGKTAVKEATLKEVGQALT
TVPEGFNLHKTVGRQLEAKKAMFDNGTGFDWATAEALAFGSLQLEGYPVRLSGQDATRGT
FSQRHSAFIDQQTEDRYYPLNHIREGQAQYEVIDSMLSEYAVLGFEYGYSLAEPNALTMW
EAQFGDFANGAQIMFDQFICSGESKWLRMSGLVMLLPHGFEGQGPEHSSARLERFLQLCG
GDNWIVANCSTPANYFHILRRQLHRNFRKPLVLMTPKSLLRHKLCVSDMADFAEGSSFHR
VLWDDADTEKKTGRSTANLVSDDKIKRVVMCSGKVYYDLLEERDARGIDDVYILRLEQFY
PFPAQSMMKELERFKDAEMVWCQEEPRNQGAWTFVEPNIEWVLTRIKAKHKRPVYAGRAP
SASPATGLASQHKAQQEALVNEALTIEGK
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcaatccccgaacgacgtgttccacgcatcatccttcctgcaaggccacaat
gcggagtatattgagcaactttacgctcgttatgctgacaaccccaatgcagtcgacgaa
agctggcgcgatttctttgcatcgctcggcgacactccgtctgaggcaaaagccgaagcc
gcaggtgcatcgtggacccgccatgactggccgccggttccgaacgacgacctgaccgct
gcgctggatggccagtggccggcagacgccaaggcggctggggataagatcaaagcgaaa
gccgccgaaaagggcgcttcgatctctgaagagcaagttcgtctcgcggttctggactcg
atccgcgcgctgatgatcatccgcgcctatcgtatccgtggtcacctgatcgctgacctt
gatccgctgggcatgcgcgacactgttccgcatccagagttggacccgaaatcctatggc
ttcacgcctgcggacatggatcgcccgatctttatcgataatgttctaggtctagaagtt
gcgaccatgaacgaaatcatggcaatcgtgcgccgcacctactgcggcacctttgctctg
caatacatgcacatctccgatcccgaacaggcgggctggctgaaagagcggatcgaaggt
ttcggtaaagagatcacttttacccagaatggccgtaaggcgatcctgaacaaactggtt
gaagccgaaggctttgagaagttcctccatgtaaaatacatgggcaccaaacgctttggt
ctggacggcggcgaaagcctcattccggcgatggaacagatcatcaagcgcgggggcgcg
ctgggtgtgaaggaaatcgtcatcggtatgccacaccgcggtcgtctgtcggttttggca
aacgtgatgtccaaaccctaccgcgcgatctttaacgaattccaaggggggtcgttcaaa
cccgaagacgttgatggttcgggcgacgtgaaataccacctcggcgcatcgtctgaccgt
tcgttcgacggcaacgaagtgcacctctcgctgaccgcgaacccatcccacctcgaagcg
gtgaaccccgttgttctgggtaaggcacgcgcgaaaaccgaccagatgaacgaccagacc
cgtcactcggttctgcctatccttctgcacggtgacgctgcattcgcaggtcagggcgtt
gtggccgaatgtttcgctctgtcaggcctgcgcggtcaccgcactggcggcaccatccac
atcgttgtgaacaaccagatcggtttcaccaccgcaccgcacttctcgcgttcgtcgccg
tatccgaccgataacgcactggtggttgaggctccgattttccacgtaaacggtgacgac
ccagaggccgttgttcacgctgcgaaagttgcgaccgaattccgccagaagttccacaaa
gacgttgtcatcgacatcttctgctaccgccgctttggtcacaacgaaggcgacgagccg
atgttcaccaacccggcgatgtacaaccgcatcaaaaagcacaaaaccacgctccagctc
tatacagagcgtctggtcaaagacggcctgatccccgaaggcgaaatcgaggatatgaag
gcacagttccaagcccttctgaacgaagagttcgaagctggccgtgaatacaagccgaac
aaagctgactggcttgatggccgttggtcgcacatggaccgtcagaagcagggcaaatat
cagcgcggcaaaaccgcggtgaaagaagcgacccttaaagaagttggtcaggctctgacc
accgttcctgagggcttcaacctgcacaaaacggtgggtcgccagctcgaagcgaaaaag
gcgatgtttgacaacggtactggctttgactgggcaaccgcagaggcattagcctttggc
tcgctccaactcgaaggctatcccgttcgtctatcgggtcaggacgcaacacgcggcact
ttctcgcagcgtcattcggccttcatcgaccagcagaccgaagatcggtactacccgctg
aaccacatccgcgagggtcaggctcagtacgaagtgatcgactccatgctgtccgaatac
gcggttctgggcttcgaatacggctactcgttggctgaaccgaacgctctgaccatgtgg
gaagcccagttcggcgacttcgcaaacggcgcgcagatcatgttcgaccagttcatctgt
tcgggtgaatcaaagtggctccgtatgtcgggcctcgtgatgctcctgccgcacggcttc
gaaggtcaaggtccggaacactcctccgcacgcctcgagcgcttcttgcagctctgtggt
ggtgacaactggatcgttgcaaactgctcgaccccagcgaactacttccacatcctgcgt
cgccagttgcaccgcaatttccgtaagccgctggttctgatgacgccgaaatcgcttctg
cgccacaaactctgcgtctcggatatggctgattttgcagaaggttcgtcgttccaccgc
gttctgtgggacgatgcggacaccgaaaagaaaaccggtcgttcgacagcgaacctcgtc
tctgacgacaagatcaagcgcgtcgtgatgtgttcgggcaaggtctattacgacctcctc
gaagagcgtgacgcacgcggcatcgacgatgtctacatcctgcgtctggaacagttctac
ccgttcccagcacagtcgatgatgaaagagcttgagcgctttaaagacgccgaaatggtt
tggtgtcaggaagagccgcgcaaccaaggtgcatggacctttgttgaacccaacatcgaa
tgggtcctcacccgcatcaaagcgaaacacaagcgtccagtctatgctggtcgcgctcca
tcggcatcgcccgcaacgggcctcgccagccaacacaaagcccaacaagaagccctcgtt
aacgaggcgctgaccatcgaaggaaaataa

DBGET integrated database retrieval system