KEGG   Desulfosporosinus orientis: Desor_2615Help
Entry
Desor_2615        CDS       T01675                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dor  Desulfosporosinus orientis
Pathway
dor03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dor00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Desor_2615
Enzymes [BR:dor01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Desor_2615
DNA repair and recombination proteins [BR:dor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Desor_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AET68164
UniProt: G7W6F7
LinkDB All DBs
Position
2698320..2700761
Genome map
AA seq 813 aa AA seqDB search
MTVKLREYNEKRNFSRTLEPEGIPENPKEGLRFVVQHHIARRDHYDLRLEWDGALLSWAV
PKGPSYNTRDKRLAVEVEDHPLEYRNFEGTIPKGEYGGGVVMLWDEGMWEPYVDVGEGLR
SGVLKFILKGRRLKGKWALVRLKRKAGETQDNWLLLKEKDEYANPEDGISEFTTSIRTGR
TMREIEEGEDEKITQNPFSSTVVQLAKLVSTIPKGEDWLYELKYDGYRILAYIEGNSVRL
ITRNGHDFTQRFQDVAYSLVDWAGGRAMILDGEMTITDAAGKTDFQALQNYMKNPQAQNL
TYIIFDLLALDGGDLRGQPLIDRKTTLAALLEDAPQNLYYSRHIPGKGKESFTAACEAGM
EGIVGKKAASVYSGTRNGDWIKLKCEHRQEFVVGGYTLSNRKTRGISSLILGVYSGGELV
YAGRVGTGLSEADMRELAEIFANLKRKVPPFRMAPRPKSNEQITWLEPELVAEIKFAEWT
SDNLLRQASFKGLRRDKNPRDIKKEIEEEETLSPSFPKEEARPMKARDKSLIIEGIKISN
PDKVIFAEPEITKRDVIRYYEKVAERMLPYVSHRVLSIVRCPKGISQTCFYKKHPGPGSR
GIVTIPVSSSDGETNDYFYIENSKGLIYEAQMGTLEFHIWGSRVDELEKPDLMVFDLDPD
EGMDLSRVRQGVRDMRDILAELSLNSYLKTSGGKGYHVVVPLKPVVSWDVFYDFAKRVAQ
VMEQKWPDRYTSNVRKAKRTNKIFIDWIRNGRGATSIAPYSLRARKGAGVSMPIDWDELD
RVAPGGVDMAEALRRIGCHDPWQDFFRNHQRLK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaaactcagggagtacaacgaaaaaagaaatttctccagaaccctggagccg
gaaggcataccggaaaaccctaaagaagggctgaggtttgtagtccagcaccatatagcc
cgcagggatcactacgatctccgtctggagtgggacggggccttattgagctgggccgtg
cctaaaggcccctcctataatacccgggacaagaggctggccgtagaggtggaggatcat
cccctggaatacaggaactttgaggggacaattcccaaaggggaatatggcggcggtgtg
gtcatgctctgggatgaaggcatgtgggaaccctacgtggatgtaggggagggactccgc
tcaggtgtgctgaaatttatcctcaagggacggcggcttaaaggcaagtgggctctggtg
cgtttgaaaagaaaagcgggggagacccaggataactggctgctgctgaaagaaaaagat
gagtatgccaatcccgaagacggaatttccgagtttactaccagcatccgaacgggacgc
accatgagggaaattgaagaaggggaagacgaaaagataacccagaaccctttcagcagt
acggttgtgcagctggccaaactggttagtacaattccaaagggtgaggattggctctat
gagctgaaatacgatggctacaggatactggcctatatcgaaggcaatagcgtcaggctg
atcaccaggaacggccatgattttacccagcggttccaggatgtggcttattccctggtg
gattgggctgggggcagggcaatgattctggacggggagatgaccatcacggatgctgcg
gggaagacggattttcaggcactgcagaattatatgaaaaatccccaggcccaaaacctg
acctatattatctttgatcttctggccttggatggaggggatctccggggacagcccctc
attgacaggaagacaaccttggcagccttgctggaggatgcccctcaaaatctctactac
agccggcatattccagggaagggcaaagaaagtttcactgcggcttgtgaggcgggcatg
gaagggatcgtgggcaaaaaagccgcttccgtctacagcggaaccagaaacggtgactgg
attaaacttaaatgcgagcataggcaggaattcgtggtaggaggctatactctttctaat
cgaaaaaccagggggataagttctctgatcctgggggtctattccggtggggaattagtc
tatgccggacgggtcggcaccgggctgagcgaagctgacatgagagagctggcggaaatc
tttgcgaacctcaagagaaaggtcccccctttccggatggcgcctagacctaagtccaat
gagcagatcacttggctggaaccggaactggtggcggaaataaaatttgccgaatggacg
tcagacaatctattaaggcaggccagttttaaaggcctgcgcagggataagaatcccagg
gatattaaaaaggaaatagaggaggaggaaaccctgtcaccttcatttcctaaagaagag
gcgaggcctatgaaggcccgggacaaaagtctcattatcgaaggaatcaagatcagcaac
cccgacaaggtgatttttgctgagcctgaaatcaccaaaagggatgtgatccgctattac
gaaaaggtggcggaacgcatgctgccttatgtgagccatcgggttctcagtattgtccgc
tgtcccaaaggcatctctcagacctgcttctataaaaagcatcccggtccgggcagtcgg
ggaatcgtcactattcctgtctcctccagtgacggggagacgaatgactacttttatatt
gagaattcaaaggggctgatctacgaagcccaaatgggcaccctggaatttcatatctgg
ggaagtcgtgtggatgagctggaaaagccggatctcatggtctttgatctggaccctgat
gaggggatggatctaagcagggtgcgccagggtgtgcgggatatgagggatattctggcc
gagctatccctgaattcctaccttaagaccagcggcggcaaagggtaccatgtggttgtg
cctttaaagcctgtcgtttcctgggatgttttttatgattttgctaaacgggttgcccaa
gtgatggagcagaagtggccggaccgctacaccagcaatgtgcgcaaggccaagcgcacc
aacaagattttcatcgattggattcgcaatggcagaggcgctaccagcattgccccttat
tccctgcgagcgagaaaaggggcgggagtgtccatgcccatagattgggatgagctagac
agggtggctcccggaggcgtagacatggcggaggccctccggaggatcggatgccatgat
ccctggcaggattttttccggaatcaccaacggcttaaatga

DBGET integrated database retrieval system