KEGG   Dipodomys ordii (Ord's kangaroo rat): 105981830
Entry
105981830         CDS       T07834                                 
Symbol
Mapk3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dord  Dipodomys ordii (Ord's kangaroo rat)
Pathway
dord01521  EGFR tyrosine kinase inhibitor resistance
dord01522  Endocrine resistance
dord01524  Platinum drug resistance
dord04010  MAPK signaling pathway
dord04012  ErbB signaling pathway
dord04014  Ras signaling pathway
dord04015  Rap1 signaling pathway
dord04022  cGMP-PKG signaling pathway
dord04024  cAMP signaling pathway
dord04062  Chemokine signaling pathway
dord04066  HIF-1 signaling pathway
dord04068  FoxO signaling pathway
dord04071  Sphingolipid signaling pathway
dord04072  Phospholipase D signaling pathway
dord04114  Oocyte meiosis
dord04140  Autophagy - animal
dord04148  Efferocytosis
dord04150  mTOR signaling pathway
dord04151  PI3K-Akt signaling pathway
dord04210  Apoptosis
dord04218  Cellular senescence
dord04261  Adrenergic signaling in cardiomyocytes
dord04270  Vascular smooth muscle contraction
dord04350  TGF-beta signaling pathway
dord04360  Axon guidance
dord04370  VEGF signaling pathway
dord04371  Apelin signaling pathway
dord04380  Osteoclast differentiation
dord04510  Focal adhesion
dord04520  Adherens junction
dord04540  Gap junction
dord04550  Signaling pathways regulating pluripotency of stem cells
dord04611  Platelet activation
dord04613  Neutrophil extracellular trap formation
dord04620  Toll-like receptor signaling pathway
dord04621  NOD-like receptor signaling pathway
dord04625  C-type lectin receptor signaling pathway
dord04650  Natural killer cell mediated cytotoxicity
dord04657  IL-17 signaling pathway
dord04658  Th1 and Th2 cell differentiation
dord04659  Th17 cell differentiation
dord04660  T cell receptor signaling pathway
dord04662  B cell receptor signaling pathway
dord04664  Fc epsilon RI signaling pathway
dord04666  Fc gamma R-mediated phagocytosis
dord04668  TNF signaling pathway
dord04713  Circadian entrainment
dord04720  Long-term potentiation
dord04722  Neurotrophin signaling pathway
dord04723  Retrograde endocannabinoid signaling
dord04724  Glutamatergic synapse
dord04725  Cholinergic synapse
dord04726  Serotonergic synapse
dord04730  Long-term depression
dord04810  Regulation of actin cytoskeleton
dord04910  Insulin signaling pathway
dord04912  GnRH signaling pathway
dord04914  Progesterone-mediated oocyte maturation
dord04915  Estrogen signaling pathway
dord04916  Melanogenesis
dord04917  Prolactin signaling pathway
dord04919  Thyroid hormone signaling pathway
dord04921  Oxytocin signaling pathway
dord04926  Relaxin signaling pathway
dord04928  Parathyroid hormone synthesis, secretion and action
dord04929  GnRH secretion
dord04930  Type II diabetes mellitus
dord04933  AGE-RAGE signaling pathway in diabetic complications
dord04934  Cushing syndrome
dord04935  Growth hormone synthesis, secretion and action
dord04960  Aldosterone-regulated sodium reabsorption
dord05010  Alzheimer disease
dord05020  Prion disease
dord05022  Pathways of neurodegeneration - multiple diseases
dord05034  Alcoholism
dord05132  Salmonella infection
dord05133  Pertussis
dord05135  Yersinia infection
dord05140  Leishmaniasis
dord05142  Chagas disease
dord05145  Toxoplasmosis
dord05152  Tuberculosis
dord05160  Hepatitis C
dord05161  Hepatitis B
dord05163  Human cytomegalovirus infection
dord05164  Influenza A
dord05165  Human papillomavirus infection
dord05166  Human T-cell leukemia virus 1 infection
dord05167  Kaposi sarcoma-associated herpesvirus infection
dord05170  Human immunodeficiency virus 1 infection
dord05171  Coronavirus disease - COVID-19
dord05200  Pathways in cancer
dord05203  Viral carcinogenesis
dord05205  Proteoglycans in cancer
dord05206  MicroRNAs in cancer
dord05207  Chemical carcinogenesis - receptor activation
dord05208  Chemical carcinogenesis - reactive oxygen species
dord05210  Colorectal cancer
dord05211  Renal cell carcinoma
dord05212  Pancreatic cancer
dord05213  Endometrial cancer
dord05214  Glioma
dord05215  Prostate cancer
dord05216  Thyroid cancer
dord05218  Melanoma
dord05219  Bladder cancer
dord05220  Chronic myeloid leukemia
dord05221  Acute myeloid leukemia
dord05223  Non-small cell lung cancer
dord05224  Breast cancer
dord05225  Hepatocellular carcinoma
dord05226  Gastric cancer
dord05230  Central carbon metabolism in cancer
dord05231  Choline metabolism in cancer
dord05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dord05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dord00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105981830 (Mapk3)
   04012 ErbB signaling pathway
    105981830 (Mapk3)
   04014 Ras signaling pathway
    105981830 (Mapk3)
   04015 Rap1 signaling pathway
    105981830 (Mapk3)
   04350 TGF-beta signaling pathway
    105981830 (Mapk3)
   04370 VEGF signaling pathway
    105981830 (Mapk3)
   04371 Apelin signaling pathway
    105981830 (Mapk3)
   04668 TNF signaling pathway
    105981830 (Mapk3)
   04066 HIF-1 signaling pathway
    105981830 (Mapk3)
   04068 FoxO signaling pathway
    105981830 (Mapk3)
   04072 Phospholipase D signaling pathway
    105981830 (Mapk3)
   04071 Sphingolipid signaling pathway
    105981830 (Mapk3)
   04024 cAMP signaling pathway
    105981830 (Mapk3)
   04022 cGMP-PKG signaling pathway
    105981830 (Mapk3)
   04151 PI3K-Akt signaling pathway
    105981830 (Mapk3)
   04150 mTOR signaling pathway
    105981830 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105981830 (Mapk3)
   04148 Efferocytosis
    105981830 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105981830 (Mapk3)
   04210 Apoptosis
    105981830 (Mapk3)
   04218 Cellular senescence
    105981830 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105981830 (Mapk3)
   04520 Adherens junction
    105981830 (Mapk3)
   04540 Gap junction
    105981830 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    105981830 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105981830 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105981830 (Mapk3)
   04613 Neutrophil extracellular trap formation
    105981830 (Mapk3)
   04620 Toll-like receptor signaling pathway
    105981830 (Mapk3)
   04621 NOD-like receptor signaling pathway
    105981830 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    105981830 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    105981830 (Mapk3)
   04660 T cell receptor signaling pathway
    105981830 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    105981830 (Mapk3)
   04659 Th17 cell differentiation
    105981830 (Mapk3)
   04657 IL-17 signaling pathway
    105981830 (Mapk3)
   04662 B cell receptor signaling pathway
    105981830 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    105981830 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    105981830 (Mapk3)
   04062 Chemokine signaling pathway
    105981830 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105981830 (Mapk3)
   04929 GnRH secretion
    105981830 (Mapk3)
   04912 GnRH signaling pathway
    105981830 (Mapk3)
   04915 Estrogen signaling pathway
    105981830 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    105981830 (Mapk3)
   04917 Prolactin signaling pathway
    105981830 (Mapk3)
   04921 Oxytocin signaling pathway
    105981830 (Mapk3)
   04926 Relaxin signaling pathway
    105981830 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    105981830 (Mapk3)
   04919 Thyroid hormone signaling pathway
    105981830 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    105981830 (Mapk3)
   04916 Melanogenesis
    105981830 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105981830 (Mapk3)
   04270 Vascular smooth muscle contraction
    105981830 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105981830 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    105981830 (Mapk3)
   04725 Cholinergic synapse
    105981830 (Mapk3)
   04726 Serotonergic synapse
    105981830 (Mapk3)
   04720 Long-term potentiation
    105981830 (Mapk3)
   04730 Long-term depression
    105981830 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    105981830 (Mapk3)
   04722 Neurotrophin signaling pathway
    105981830 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    105981830 (Mapk3)
   04380 Osteoclast differentiation
    105981830 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105981830 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105981830 (Mapk3)
   05206 MicroRNAs in cancer
    105981830 (Mapk3)
   05205 Proteoglycans in cancer
    105981830 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    105981830 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    105981830 (Mapk3)
   05203 Viral carcinogenesis
    105981830 (Mapk3)
   05230 Central carbon metabolism in cancer
    105981830 (Mapk3)
   05231 Choline metabolism in cancer
    105981830 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105981830 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105981830 (Mapk3)
   05212 Pancreatic cancer
    105981830 (Mapk3)
   05225 Hepatocellular carcinoma
    105981830 (Mapk3)
   05226 Gastric cancer
    105981830 (Mapk3)
   05214 Glioma
    105981830 (Mapk3)
   05216 Thyroid cancer
    105981830 (Mapk3)
   05221 Acute myeloid leukemia
    105981830 (Mapk3)
   05220 Chronic myeloid leukemia
    105981830 (Mapk3)
   05218 Melanoma
    105981830 (Mapk3)
   05211 Renal cell carcinoma
    105981830 (Mapk3)
   05219 Bladder cancer
    105981830 (Mapk3)
   05215 Prostate cancer
    105981830 (Mapk3)
   05213 Endometrial cancer
    105981830 (Mapk3)
   05224 Breast cancer
    105981830 (Mapk3)
   05223 Non-small cell lung cancer
    105981830 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105981830 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    105981830 (Mapk3)
   05161 Hepatitis B
    105981830 (Mapk3)
   05160 Hepatitis C
    105981830 (Mapk3)
   05171 Coronavirus disease - COVID-19
    105981830 (Mapk3)
   05164 Influenza A
    105981830 (Mapk3)
   05163 Human cytomegalovirus infection
    105981830 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105981830 (Mapk3)
   05165 Human papillomavirus infection
    105981830 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105981830 (Mapk3)
   05135 Yersinia infection
    105981830 (Mapk3)
   05133 Pertussis
    105981830 (Mapk3)
   05152 Tuberculosis
    105981830 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105981830 (Mapk3)
   05140 Leishmaniasis
    105981830 (Mapk3)
   05142 Chagas disease
    105981830 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105981830 (Mapk3)
   05020 Prion disease
    105981830 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    105981830 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    105981830 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105981830 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105981830 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105981830 (Mapk3)
   04934 Cushing syndrome
    105981830 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105981830 (Mapk3)
   01524 Platinum drug resistance
    105981830 (Mapk3)
   01522 Endocrine resistance
    105981830 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dord01001]
    105981830 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dord03036]
    105981830 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dord04147]
    105981830 (Mapk3)
Enzymes [BR:dord01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105981830 (Mapk3)
Protein kinases [BR:dord01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105981830 (Mapk3)
Chromosome and associated proteins [BR:dord03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105981830 (Mapk3)
Exosome [BR:dord04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105981830 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 YukC Kdo
Other DBs
NCBI-GeneID: 105981830
NCBI-ProteinID: XP_012866632
Ensembl: ENSDORG00000003370
UniProt: A0A1S3ET79
LinkDB
Position
Unknown
AA seq 364 aa
GADGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISP
FEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKS
QQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTNCDLKICDFGLARIADPEH
DHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLN
HILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNP
NKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGG
PDAP
NT seq 1095 nt   +upstreamnt  +downstreamnt
ggagccgatggggtcggcccgggggtcccgggggaagtggaggtcgtgaaggggcagccg
ttcgacgtgggcccgcgctacacgcagctgcagtacatcggcgagggggcgtacggcatg
gtcagctccgcttatgaccacgtgcgtaagactcgggtggccatcaagaagatcagcccc
tttgagcatcagacctactgccagcgcacgctccgggagatccagatcctgctgcgcttc
cgccatgagaatgtcataggcatccgagacattcttcgggcacccacactggaagccatg
agggatgtctacattgttcaggacctgatggagacagatctatacaaattgctcaaaagc
cagcagctgagcaatgaccacatctgctacttcctctaccagatcttgcgcggcctcaag
tatatccactcggccaatgtgctccaccgggacctgaagccctccaacctgctcatcaac
accaactgcgaccttaagatatgcgatttcggcctggcccgcattgcagatcctgaacat
gaccacacgggctttctgacggaatatgtggccacacgctggtaccgggcccccgagatc
atgcttaactccaagggctataccaagtccatcgacatctggtctgtgggctgcattctg
gctgaaatgctctccaatcggcccatcttccctggcaagcactacctggaccagctcaac
cacattctgggtatcctgggctccccatcccaggaagacctgaactgtatcatcaacatg
aaggctcgaaactacctacagtctctgccatccaagaccaaggtggcctgggccaagctc
tttcccaagtcagactccaaagctcttgacctgctggatcggatgttaaccttcaatccc
aacaagcggatcaccgtggaggaagccctggcccacccctacctggagcagtactacgat
cccacggatgagccagtggctgaggagcccttcactttcgacatggagctggatgaccta
cccaaggagcggctgaaggagctcatcttccaggagacagcccgcttccagccagggggc
ccagacgccccttaa

DBGET integrated database retrieval system