KEGG   Draconibacterium orientale: FH5T_13900Help
Entry
FH5T_13900        CDS       T03072                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
dori  Draconibacterium orientale
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dori00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    FH5T_13900
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FH5T_13900
Enzymes [BR:dori01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     FH5T_13900
Bacterial toxins [BR:dori02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   FH5T_13900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3287174..3288805)
Genome map
AA seq 543 aa AA seqDB search
MKNYLLILLAVCGMYISGCTPKIQNEIEGATNASVSQKRVPLFLDRENPEVFQLNLGIEQ
GITFNLKNITLVLTEGSNAEMLKSLSAKWTAAFSNDTITTNYATDFLLAGNEIVLEGDAV
LTSGNHTLAIQFQVKDDAVLTQHFSVEKAILTLGNERLAIDVEQPFAFRPAKVVRAAGQD
NCDTYRIPGLVTTDKGTLIAVYDNRYNNSKDLQEDIDIGMSRSTDGGQTWEPMKVIMDMG
EWGGLPQELNGIGDPSVLYDPVNHTIWVAAVWMNGFDKSQMGWWASKPGMSPEETGQFML
VKSTDDGLTWSEPINITEQIKDPAWQYLLQGPGKGITLADGTLVFPAQFKAELDEKAIDG
GPYTPHSTLIYSKDGGETWTIGTGAKTNTTEAQVVELSDGSLMLNMRDDRNRKDKSETNG
RAVAITKDLGKTWEIHPSSNSALQEPNCMASLIATDLTFDGADKRVLFFSNPNNKNHRTN
MTIKASLDEGITWPEAAQVELNEAGGFGYSCMTMIDDETVGILYEGVKELYFQSIPVADI
LQQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattacctgcttattctactagccgtatgcggaatgtacatctccggatgtacc
ccaaaaatccagaacgaaatagaaggcgcaaccaacgcttctgtcagtcaaaaaagagtt
ccgctatttttggaccgcgaaaatcccgaagtttttcaactaaatctcggcattgagcag
ggcattactttcaaccttaaaaacattaccctcgtacttaccgaaggcagtaacgctgaa
atgctgaaatcacttagtgcgaaatggactgctgcttttagcaacgacaccataactaca
aattatgcaacagactttcttcttgccggtaatgaaatagtacttgaaggcgatgcagta
cttacctccggaaaccataccctggctattcagtttcaggtgaaagatgatgccgtatta
acacagcatttttcagttgaaaaagccattttaacattgggcaacgaacgcctggccatc
gacgttgagcagccttttgctttccgtcccgcaaaggtggtacgcgctgccggtcaggac
aattgcgacacttaccgcattcccggattagttacaaccgacaaaggaacgctgattgcc
gtttacgataaccgctacaacaacagcaaagatttacaggaagacattgatataggtatg
agccgaagtaccgatggcggacaaacctgggaacccatgaaagtaattatggatatgggc
gaatggggcggtttgccgcaggagttaaatggcattggcgatcccagcgtgttgtacgat
cctgtaaaccacaccatttgggtagccgcagtttggatgaacggattcgacaaaagtcaa
atgggctggtgggcttcaaaacccggaatgtcgcccgaggaaaccggccagtttatgctg
gtaaaaagtaccgacgacggattaacctggtcggagccaattaatattaccgaacaaatt
aaagacccggcgtggcagtacctgctgcaaggccccggaaaaggaattacactggcagac
ggaaccctggtgttcccggcacagtttaaagccgaactggacgaaaaagcaattgatggc
ggcccttacacgccacattctacactgatatacagcaaagacggcggcgaaacatggacc
attggaacaggtgccaaaacaaatacgaccgaagcacaggtggtagaattaagcgatggc
agcctgatgctgaacatgcgcgacgaccgcaaccgaaaagataaatcggaaacaaacggt
cgtgccgttgccattacaaaagaccttggtaaaacctgggagatccatccttcgtcgaat
tcggcactgcaggaaccgaattgtatggccagtttgattgctactgatttaaccttcgat
ggagcagacaaacgagtgctgttcttttcaaacccaaataacaaaaatcatcgtaccaac
atgaccataaaagccagcctcgatgaaggaatcacctggcccgaagccgctcaggtagaa
cttaacgaagccggtggctttggctattcgtgcatgactatgattgatgacgaaaccgtt
gggattctgtatgaaggggtaaaagaactttattttcagagcattcctgttgcggatatt
ttacaacaataa

DBGET integrated database retrieval system