KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0208700-01Help
Entry
Os01t0208700-01   CDS       T02163                                 

Gene name
Os01g0208700
Definition
(RAP-DB) Similar to Phosphoenolpyruvate carboxylase (Fragment).
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Os01t0208700-01 (Os01g0208700)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os01t0208700-01 (Os01g0208700)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Os01t0208700-01 (Os01g0208700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
LinkDB All DBs
Position
chr01:join(5899719..5900021,5900124..5900518,5900619..5900703,5900810..5901032,5901131..5901234,5901531..5901621,5906914..5907068,5907241..5908632,5908973..5909269)
AA seq 1014 aa AA seqDB search
MISLHSAPFTLLVKLPGRRRSGLTPPRCAVRGAGNVSSAAVREMAVAEGRRQHEYSIDAR
LRQLAPEKVSADDRLVDYETLLVARFLDILEDLHGGDFRQVVEDCLRLSGEYQSEGDPAR
LGELGGLLTSLDVGDAIMVASSFSHMLNLANLAEEIQMVYRKKAEASRRGDFVDEASAPT
ESDIDETFQRLVRGLGKSPREVFDALRSQTIDLVLTAHPTQSVRRSLLQKHASIRSCLTQ
LCGEGISDNEEQEIDEALQREILAAFKTDEIRRTPPTPQDEMRAGMSYFHDTIWNGVPKF
LRRVDTALKNIGIDERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANMY
FSKMADLMFELSMWRCNDELRARANELHRKSSRKYAKYYIEFWKKISPGEPYRIILGDVR
DKLYNTCERARQILSKGISSIPEDQTYTNVEQFLEPLELCYRSLCDCGDKLIADGRLLDL
MRQVSTFGLSLVKLDIRQESERHTDAMDAITTHLGIGSYREWPEERRQEWLVSELRGRRP
LFGPDLPQSEEVADVLGAFRVIAELPADSFGAYIISMATAPSDVLAVELLQRECGVKKPL
RVVPLFEKLADLQQARATMELLFSVDWYKERIDGKQEIMIGYSDSGKDAGRLSAAWQLYK
AQEEIVGVAERHGVKLTIFHGRGGTVGRGGGPSHLAILSQPPNTVNGSLRVTVQGEVIEK
SFGEENLCFRTLQRFTAATLEHGMNPPVSPKPEWRRLLDDMATVATDEYRSIVFQEPRFV
EYFRAATPETEYGRMNIGSRPSKRKPGGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFR
HAMQQSDAGGGLATLREMYDEWPFFRVTIDLLEMVFAKGDPGIAALYDELLVPDDLRPFG
EQLRANYVETQRLLLQVAGHKDLLESDPYLRQRLMLRDSYITALNVCQAYTLKRIRDGGF
RPETRPPLSKELLGSSAVAEKLVKLNPNSEYDPGLEDTLILTMKGIAAGMQNTG
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgatctccctccactccgcccccttcaccctcctcgtaaagctccccggccggaggagg
agcggtcttacgccgccgaggtgcgccgtccggggagccgggaacgtgtcgtcggcggcg
gtgcgggagatggcggtcgcggaggggcggcggcagcatgagtactccatcgacgcacgc
ctccggcagctcgcgccggagaaggtgtccgccgacgaccgcctcgtcgactacgagacc
ctcctcgtcgcgcgcttcctcgacatcctcgaggacctccacggcggcgacttcagacaa
gtggtggaggattgcctgaggctgtccggggagtaccagagcgagggcgacccggcgagg
ctgggcgagctgggcggcctcctgacgagcctggacgtgggcgacgccatcatggtggcg
agctccttctcccacatgctcaacctggccaacctcgccgaggagatccagatggtgtac
cgcaagaaggcggaggcgagccggcgcggggacttcgtcgacgaggcctccgcgcccacc
gagtccgacatcgacgagacgttccagcgcctcgtccgcggccttggcaagtccccccgc
gaggtgttcgatgcgctccgcagccagaccatcgacctcgtcctcaccgcccaccccacg
cagtccgtcaggcgttcactcctccagaagcacgcaagcattaggagctgcctgacacag
ctctgcggcgagggcatctccgacaacgaggagcaggagatcgacgaggcccttcagaga
gagattctcgcggcgttcaagacggacgagatccggcggacgccgccgacgccgcaggac
gagatgcgcgccgggatgagctacttccacgacaccatctggaacggcgtgcccaagttc
ctccggcgcgtcgacacagcgctcaagaacatcggcatcgacgagcgcctcccctacaac
gcccccctcatccagttctcctcatggatgggcggcgatcgcgacgggaatccgagggtt
acaccagaggttaccagggacgtgtgcctgcttgccaggatgatggctgccaacatgtac
ttctccaagatggccgatttgatgttcgagctctccatgtggcgctgcaacgacgagctc
cgagctcgtgccaacgagttgcaccggaagtcctcaaggaagtacgccaaatactacatt
gagttttggaagaagatttctccaggagaaccttaccgcattatactcggcgatgtgagg
gacaagctgtacaacacctgcgagcgtgctcgccagatcttgtcgaagggaatttctagc
attcctgaagaccagacttacaccaatgtcgagcagttcttggagccgcttgagctgtgc
taccgatcgctgtgcgactgcggcgacaagctgatcgccgacggcagactgctcgactta
atgcggcaggtctccaccttcggcctctccctcgtcaagctcgacatccggcaggagtcg
gagcgccacaccgacgccatggacgcgatcaccacgcacctcggcatcggctcctaccgg
gagtggcccgaggagcggcgccaggagtggctcgtctccgagctccgcggcaggcgcccg
ctcttcggccccgacctgccgcagtccgaggaggtcgccgacgtgctcggcgcgttccgg
gtcatcgccgagctccccgccgacagcttcggcgcgtacattatctccatggccaccgcg
ccgtccgacgtgctcgccgtcgagctgctgcagcgggagtgcggcgtcaagaagcccctg
agggtcgtcccgctgttcgagaagctcgccgaccttcagcaggcgcgcgccaccatggag
ctcctcttctccgtcgactggtacaaggagcggatcgacgggaagcaggagatcatgatc
gggtactccgactccggcaaggacgccggccggctgtccgcggcgtggcagctgtacaag
gcccaggaggagatcgtcggcgtggcggagcggcacggcgtgaagctgaccatcttccac
ggccggggcggcaccgtggggcgcggcggcgggccgagccacctcgccatcctgtcccag
ccgccgaacaccgtcaatggctcgctccgcgtgactgtccagggcgaggtcatcgagaag
tcgttcggcgaggagaacctctgcttccggacgctgcagaggttcacggcggcgaccctg
gagcacggcatgaacccgccggtgtccccgaagcccgagtggcgccgcctgctcgacgac
atggcgacggtggccactgacgagtaccgctccatcgtgttccaggagccgcgcttcgtg
gagtacttccgcgccgccacgccggagacggagtacgggcggatgaacatcggcagccgg
ccgtcgaagcggaagcccggcggcggcatcgagtcgctgcgcgccatcccgtggatcttc
gcgtggacgcagacgcggttccacctccccgtgtggctgggcttcggcgccgcgttcagg
cacgccatgcagcagagcgacgccggcggcggcctcgccacgctccgcgagatgtacgac
gagtggcccttcttccgcgtcaccatcgacctcctcgagatggtcttcgccaagggcgac
cccggcatcgccgcactctacgacgagctcctcgtccccgacgacctacgtccattcggc
gagcagctcagagccaactacgtcgagacacagcgcctgctcctgcaagttgctgggcac
aaggatctcctggagagtgatccgtacctgaggcagcggctgatgctgcgggactcgtac
atcacggcgctgaacgtgtgccaggcgtacacgctgaagcggatccgggacggcgggttc
aggccggagacgcggccgccgctgtcgaaggagcttctgggctcgtcggcggtggcggag
aagctggtgaagctcaacccaaacagcgagtacgaccccgggctggaggacacgctcatc
ctcaccatgaagggcatcgccgccggcatgcagaacacgggctga

DBGET integrated database retrieval system