KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0152400-01Help
Entry
Os02t0152400-01   CDS       T02163                                 

Gene name
Os02g0152400
Definition
(RAP-DB) Similar to Ribulose bisphosphate carboxylase (EC 4.1.1.39) (Fragment).
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Os02t0152400-01 (Os02g0152400)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os02t0152400-01 (Os02g0152400)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Os02t0152400-01 (Os02g0152400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
LinkDB All DBs
Position
chr02:join(2875087..2875242,2875403..2875534,2875680..2875943)
AA seq 183 aa AA seqDB search
MFINTASFVAGAVVASPEQPAKLVRDQRRVVPGSCRARRGAASNGFRTYCMQTWNPFTNR
RYEAMSYLPPLSAKSISKEIEFIMSKGWVPCLEFDKEGEIHRSNSRMPGYYDGRYWTLWK
LPMFGCSDAAAVLREVEECRREYPDAFIRLIAFDSSRQCQCMSFVVHKPPSAAASPATVA
GAE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcaacacggccagcttcgtcgccggcgccgtcgtcgcttcgccggagcagccg
gccaagcttgtccgggatcagaggagggtggtgcctggctcctgcagggcaagaagaggt
gcagcatccaatggcttcagaacttactgcatgcagacatggaaccctttcaccaacagg
aggtacgaggcgatgtcttacctgcctcccctgagcgcgaagtccatctccaaggagatc
gagttcatcatgtccaaaggatgggtcccttgcctcgagtttgacaaggagggggagatc
caccggagcaacagccggatgccggggtactacgacgggaggtactggacgctgtggaag
ctgccgatgttcggatgctctgacgcggcggcggtgctccgggaggtggaggaatgccgg
agggagtacccggacgccttcatccgcctcatcgccttcgacagcagccgccagtgccag
tgcatgtccttcgtcgtccacaagccgccgtcggccgccgcttctccggccacggtcgcc
ggagctgaatga

DBGET integrated database retrieval system