KEGG   Danaus plexippus (monarch butterfly): KGM_209537Help
Entry
KGM_209537        CDS       T04344                                 

Definition
(GenBank) vitellin-degrading protease precursor
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpl00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    KGM_209537
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     KGM_209537
Peptidases [BR:dpl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   KGM_209537
Exosome [BR:dpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KGM_209537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 263 aa AA seqDB search
MFKLLLLLVIIGYVVSKPYVDDARIVGGEDIDITGAPYQVSLLNRGRHFCGGSIIDNDLI
LTAAHCLLGLNKRNLQVRAGSSSNREGGVVVPVGEYVYNRDFTFHNMDSDVGLIWLQKPL
EFGPSIAPIIMSDEDEEIDDGELTVVTGWGNLRENGGTPKTLQMVLVPKVSATACSNAYA
PSYNITPRMLCAGTPEGGKDACQGDSGGPLVYNEKLAGVVSWGLGCARPKYPGVYAKVSA
LREWIDEKAIYLKLKHIFRPVLY
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacttcttttattactcgttattattggatacgtggtatcaaaaccatacgta
gatgatgcaaggattgtaggcggagaagatatagacataacgggagcgccttaccaagtt
tcattactgaaccggggcagacacttttgcggtggttctattattgacaatgatcttata
ctgactgctgcacattgtttacttggacttaacaaacgaaatttacaagtaagagctggc
tcatcatcaaatcgtgaaggcggagtagttgtaccagttggtgaatatgtgtacaatcgt
gacttcaccttccataatatggatagtgacgttggcttaatttggttacaaaagcctttg
gagtttggacccagtattgcaccaattataatgtctgatgaagatgaagaaattgatgat
ggagagttgacagttgttaccggctggggtaaccttagggaaaatggtggaactccaaag
acgttgcaaatggtgttagtaccaaaagtaagtgcaactgcttgttcaaacgcctatgct
ccatcgtataatataaccccgagaatgttgtgcgctggcacacctgaaggtggaaaagat
gcgtgtcagggtgacagtggcggtcctctagtgtataacgaaaaactcgctggcgttgtt
tcatggggtctaggttgtgctagaccaaaatatcctggagtgtatgcaaaagtgtcagcc
ctaagagaatggattgatgaaaaggcaatttatctcaaactcaagcacatttttagacct
gttttatattga

DBGET integrated database retrieval system