KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_146669Help
Entry
DICPUDRAFT_146669 CDS       T02090                                 

Gene name
gadA
Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    DICPUDRAFT_146669 (gadA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DICPUDRAFT_146669 (gadA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DICPUDRAFT_146669 (gadA)
   00430 Taurine and hypotaurine metabolism
    DICPUDRAFT_146669 (gadA)
Enzymes [BR:dpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DICPUDRAFT_146669 (gadA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 473 aa AA seqDB search
MSLHSIKSENTKEKKGNSNKYKRCYDLYAEKSATHPINKYKINDHPTDPDLSKNLILDEL
LLDGNAKQNLATFCQTDVDINIHTLMDKCIDKNMIDKDEYPQTAEIESRCVHMIADLWNS
PDSANTIGCSTTGSSEAAMLGGLALKWKWREQRKKEGKPCDRPNLITGPVQICWHKFVLY
FDIELREIPMENGRLLMSPEEVLKRCDENTIGVVPTLGVTFTLQYENVRAISDALDKYHK
ETGLDIPIHVDAASGGFVAPFITPDLVWDFRLPRVKSINASGHKYGLSPLGVGWVIWRGK
EDIHKDLIFNVNYLGGNMPTFSLNFSRPGGQIVSQYYNFIRHGREGYRAIHQACIDHGVY
IGEEIKKMGIFDLIYDGKGALPGVCWLLKKDAKVKFNLFDLSDRMKTRGWQIASYTLPKN
AESMIITRVLIRHGFSRDMASLLIDDIKRCLEYFEKHPLVKPLSKEEGEGFHH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcactacattcaataaaaagtgaaaacactaaggaaaaaaaaggaaattcaaataaa
tataaaagatgttatgatttatatgctgaaaaaagtgcaacccatccaataaataaatat
aaaattaatgatcatccaacagacccagatctttcaaaaaatttaattttggacgagttg
ttattagatggtaatgcaaagcaaaatctagcaacattctgtcaaaccgatgtagatatt
aatatccatactttaatggacaaatgtattgataaaaatatgattgataaggatgaatac
ccacaaactgctgaaatagagtcaagatgtgttcatatgattgccgatctatggaattcc
ccagattcagcaaatacaattgggtgttcaacaactggttcaagtgaggcagcaatgttg
ggtggcttagctttgaaatggaaatggagagaacaaagaaaaaaagaaggtaaaccatgt
gatagaccaaatttaatcaccggtccagttcaaatttgttggcataagtttgttttgtat
ttcgacatagagctaagagaaataccaatggaaaatggccgtttgctaatgtcacctgaa
gaagtcctcaagcgttgtgatgagaatactattggtgttgttccaactctaggtgtaacc
tttacattacagtatgaaaatgttagagccatttcagatgcattagataaataccacaaa
gaaactggtttagatatcccaattcatgtagatgccgctagcggtggtttcgttgcacca
ttcatcacaccagatttagtttgggattttagattaccacgtgtaaagtccattaatgca
tcaggtcataaatatggtttatctccattgggtgtaggttgggtaatctggaggggcaaa
gaagatatccacaaagatttaattttcaatgttaattatcttggtggtaacatgccaact
ttttctcttaacttttcgcgtccaggtggtcaaatagtttctcaatactacaactttata
cgtcacggtcgtgaagggtatagagcaattcatcaagcttgtattgaccatggtgtttac
attggggaagaaattaaaaagatgggaatctttgacttaatttatgatggcaaaggtgct
cttccaggtgtttgctggcttctcaagaaagacgctaaagtcaaatttaatctcttcgat
ctttcagatagaatgaaaactcgtggatggcaaatagcatcatatacactccccaaaaat
gcagagtctatgatcatcactcgtgtcttaatccgtcatggtttcagtcgtgatatggca
tctctacttattgatgacataaaacgttgtttggaatactttgaaaaacacccattagtt
aaacctctatctaaagaggagggtgaaggattccaccattaa

DBGET integrated database retrieval system