KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_49097Help
Entry
DICPUDRAFT_49097  CDS       T02090                                 

Definition
(RefSeq) calmodulin-binding protein ThyB
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00240  Pyrimidine metabolism
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DICPUDRAFT_49097
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DICPUDRAFT_49097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2 Flag1_repress
Motif
Other DBs
NCBI-GeneID: 10504656
NCBI-ProteinID: XP_003290301
JGI: Dicpu1_49097
UniProt: F0ZSA2
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MAIIPTVVGKIQVIFGPMFSGKTTELIRRIKRFNFANKKCLLIKYSKDTRYNDNIDKSFL
VTHDKQNYQAFPCSILEDIREQAEKYDVIGIDEGQFFPDVVQFSEELANQGKTVIIAALD
GTFQRKPFASVIDLVSKAEVITKLTAVCMVCYNDAAFSKRIVDDDNIELIGGIDKYISVC
RGCYHKDTSMKTLKSVRNVHDKALSGAVVAAHDQFYQDGPQNMAVDDIHLNNDY
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattccaacagtcgtcggtaaaattcaagttatttttggcccaatgttcagt
ggaaaaacaaccgaacttattagaagaattaaaagatttaactttgctaataagaaatgc
ttattaatcaaatatagcaaagatactagatataacgataatattgataaatcattttta
gtcacccacgataaacaaaactaccaagctttcccatgttcaattttagaagatatcaga
gaacaagctgaaaaatatgacgtcatcggtattgatgaaggacagtttttcccagatgtc
gttcaatttagtgaagaattagcaaaccaaggcaaaactgttatcattgcagctttagat
ggcactttccaaagaaaaccttttgcatctgtcattgatttagtctccaaagccgaagtt
atcaccaaattgaccgctgtttgtatggtttgttataacgatgctgctttctccaaacgt
attgtcgatgatgataacatcgagttgattggaggtattgataaatatatatcagtttgt
agaggctgttaccataaagacacctctatgaaaaccttaaaatcagttcgtaatgttcac
gacaaagctcttagcggtgccgttgtagcagcccatgatcaattctaccaagatggtcca
caaaatatggcagttgatgatattcatttaaacaatgactactaa

DBGET integrated database retrieval system