KEGG   Desulfotalea psychrophila: DP0385Help
Entry
DP0385            CDS       T00192                                 

Definition
(GenBank) probable glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
dps  Desulfotalea psychrophila
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    DP0385
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DP0385
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DP0385
   00430 Taurine and hypotaurine metabolism
    DP0385
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    DP0385
Enzymes [BR:dps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DP0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
415019..416443
Genome map
AA seq 474 aa AA seqDB search
MLRCYPRTEKEKRMPLHNKRKNNIMDDIYASSDLSIVLPKYKMPQKELDPRHAYQMVHDE
LMLDGNARQNLATFCQTWDDPEVHRLMDECIDKNMIDKDEYPQTAEIESRCVHILADLWN
APDSANSLGCSTTGSSEAAMLGGLALKKRWSEKRKAAGKGTDRPNIVCGPVQICWHKFAR
YWDVELREVPLEDQLYMTAEEAVKRCDENTIGVIPTLGVTFTCVYEPVEEICRALDQLQK
ETGLDIPVHVDGASGGFLAPFVDPDLKWDFRLKRVKSINASGHKFGLAPLGVGWVLWRDK
EELPEDLIFWVNYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGHEGYRKIHQACYKTAQY
LSSEVKKLGPFEIIYDGRGGIPAMSFSLQEGVAPGFNLFDLSDRIRSRGWQIAAYSMPAN
REDLVVMRILVRHGFSRDLADLLLKDLQHCLEYFKKNPVIHQSSEEFSGSFKHS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
ttgctcagatgctatccacgcacggaaaaggagaaaagaatgcccctgcacaacaagaga
aagaacaacatcatggatgatatctatgcatcatctgatctctccattgttcttcccaaa
tacaagatgccgcaaaaagagcttgatccccgccacgcctaccagatggttcacgacgaa
ctgatgctggatggcaatgcccggcaaaacctggcgaccttttgccagacatgggatgac
ccggaagttcacaggctgatggacgagtgtatcgataaaaacatgattgataaggatgag
tatcctcaaactgcagagattgaatcccgatgcgtgcacattctggccgatctctggaat
gccccggattctgccaacagcttgggttgctccaccaccggttccagtgaggcggccatg
ctcggtggactggccctaaaaaaacgctggagcgaaaagagaaaggccgccggcaagggc
acagacagacccaatattgtctgtggccctgtccagatatgttggcataaatttgcccgt
tactgggatgtggaactacgagaagtccccttagaggaccaactctatatgacggcggaa
gaggccgtaaagcgttgcgatgaaaacaccatcggagtcatacccaccctgggagttaca
tttacctgtgtctatgagccggtagaagagatttgcagggcccttgatcaactgcaaaaa
gagaccggcctcgacatcccagtccatgtggatggggcaagcggtggatttcttgctccc
tttgtcgatcccgatctcaaatgggactttcgcctgaaacgggtaaagtcgatcaatgcc
tcgggtcataaatttgggttggcaccactcggcgtaggctgggtgctctggcgagacaaa
gaggagctccccgaggacctcatcttctgggtcaactatctgggaggcaatatgcccacc
tttgccctcaacttctcccgcccaggaggacagattatcgcccagtactataacttccta
cgtcttggccatgagggctatcgcaaaatacaccaagcctgctacaaaacagcccaatac
ctctcaagcgaagtcaaaaaactcggcccatttgagatcatctacgatggcaggggaggc
attcccgccatgagcttctccttacaagagggcgttgccccgggattcaacctctttgac
ctatcggatcgcattaggagccgtggttggcagattgcggcctatagcatgcccgccaat
agagaggatttagtggtaatgcgcatcctcgtccgccatggtttcagccgggacttagct
gacctactcctcaaagaccttcagcactgcctggagtacttcaaaaaaaatccagttatt
caccagagcagtgaagagttctctggcagttttaagcacagctag

DBGET integrated database retrieval system