KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_304762Help
Entry
DAPPUDRAFT_304762 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dpx  Daphnia pulex (common water flea)
Brite
Enzymes [BR:dpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     DAPPUDRAFT_304762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 721 aa AA seqDB search
MSRIRLPRPPRRPVDEAGKAALKVDSVDILIAENGKDHHTFDYEMMERPVDANLVVRRGQ
PFNLVLKFNRNFDPATDAVSLIFTVADAKMPSPSNGTTIAIPVLNDNSSSLPAGGWWARL
VASSELSIKVQVCTLATSVVGVWKLDVDTKFIPTSTSLSYSLPSRIYLIFNPWCREDLVY
MEDEEWKKEYVMADSGLIWRGSHNRMRPCAWNFAQFEKDILECCVYLLSNVGKLTIAGRA
DPIRVVRAISAAVNSSDDNGVLMGNWSNDYAGGTEPTKWQGSMLILQKYWATKSPVKFGQ
CWVFSGVTTSVCRALGIPARSITNFSSAHDTHGGLTIDTFIGDDGKVVEELNSDSIWNFH
VWNEVWMQRPDLEPGNYGGWQAIDATPQEESDGVYRCGPTSVAAVKRGEVKKAFDTAFHF
AEVNADKVYWKFKGNGQPLKLIDKRTDEIGLFISTKAVGKFQREDVTDQYKHKDNSVEER
EVVLKALRQCGHLYSRYYLNEALEDVRFDFQLRDDIVIGSPFSAVVTVANRNRSKDYTVE
VTLRVDSVLYTGKLKSVIKKEVFQRTIKAGTAQNITLPVSYDEYAPELSDQCAFNIACLA
NVKETEFEFFSQDDFRVRKPDIAIKAPKEVPLGEQFDVTVSMINPLPKELNGAKFVIEGA
GLGVPHKVSVPNKVAPGKEARVVVKMTAAKAGQKTVSAKFYSKELNDVDGYLNMDVIDPT
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagaataaggctgccaagaccacctagacgtccagtcgatgaagcaggaaaagct
gcgctaaaagtggattcggtggatatccttattgccgaaaatggcaaggaccatcatacg
ttcgactatgaaatgatggagcgaccagtcgacgccaatctcgtagttcgccgaggccaa
cctttcaatcttgtattgaaatttaaccgcaactttgatccggccacagacgccgtttcc
ttgattttcaccgtcgccgatgcgaaaatgccgagtccgagtaatggtacgactatcgcc
atccccgtgctgaacgataatagcagttcgttgcccgctggaggctggtgggctagactt
gtagcctctagcgaactctctattaaagtgcaagtctgtaccctggcaacaagcgtcgtc
ggcgtctggaagttggatgttgacaccaaatttattcccacaagcacttcactgtcatat
tctttgccgtcgagaatctaccttatcttcaacccgtggtgtcgagaggacctcgtatac
atggaagatgaagaatggaagaaagaatatgtcatggcggattcgggactcatatggcgt
ggaagccataaccgcatgcgtccgtgtgcctggaactttgcacaatttgaaaaggacatc
ctggagtgttgcgtttatttgctgagcaacgttggcaaactaaccattgccggaagagct
gatccgattcgtgtcgttcgtgctatttctgctgcggtgaattcttcggatgataacggt
gtgttgatgggtaactggtccaatgattatgcaggtggtactgaacccacaaagtggcaa
ggatctatgttgattttacaaaaatactgggcaacaaaatcgccagtcaagtttggccag
tgctgggtcttttccggcgtgactacgagcgtttgtcgcgctcttggcatccctgctcgt
tccatcaccaatttctcctcggctcacgacacccacggtgggctgactattgatacattc
attggcgatgacggcaaagtggtagaggagctcaattccgattcaatctggaatttccac
gtctggaacgaagtatggatgcagagaccagatctggaacccggaaactacggaggatgg
caagctattgacgctacgccacaggaagaaagtgatggcgtctacagatgcggcccgaca
tcggtggcagctgttaagcgtggcgaagtgaaaaaggccttcgataccgcgtttcatttt
gctgaagtcaatgctgacaaagtttactggaaattcaaaggcaatggccagccattgaag
ctcattgacaagcgaactgacgaaattggcctgtttatcagtactaaagctgttggaaag
tttcaacgcgaagacgtgacagatcaatacaagcacaaagacaattcggtcgaagagaga
gaagtagttttgaaagcccttcgacagtgtggacacttgtatagtcgatattacctcaat
gaggctttagaagacgtgcgtttcgatttccagctgcgtgacgacatcgttattggatcc
cctttcagtgccgtcgtgactgttgcaaatcgtaatcgctccaaggactacaccgtagaa
gttaccctacgcgttgattcggtactgtacactggaaaactgaagagcgtgatcaaaaaa
gaagtctttcaacgaaccatcaaagctggaactgcccaaaatattactcttcccgtgtcc
tacgacgaatacgctcctgaacttagtgaccaatgtgccttcaacattgcctgcttggcc
aacgtcaaagaaaccgagtttgagttcttctcacaggatgacttccgcgttcgtaagcct
gacattgctatcaaggctcctaaagaagttccgctgggagagcagtttgacgtgactgtt
tctatgattaatcctcttccgaaggaattgaatggcgctaaattcgtcatcgaaggagct
ggtctaggcgtgcctcataaagttagcgtgcccaacaaagtggcgccaggcaaggaggcc
cgtgttgtcgttaaaatgacggctgccaaagctggacagaaaactgtctctgccaaattt
tactccaaggagctcaatgatgttgacggttatctcaatatggatgtaatcgacccaact
gcctaa

DBGET integrated database retrieval system