KEGG   Deinococcus radiodurans: DR_1019Help
Entry
DR_1019           CDS       T00025                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dra  Deinococcus radiodurans
Pathway
dra00564  Glycerophospholipid metabolism
dra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DR_1019
Enzymes [BR:dra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DR_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 GIDA NAD_binding_8 Pyr_redox_2 Thi4 Pyr_redox_3 Lycopene_cycl Pyr_redox
Motif
Other DBs
NCBI-GeneID: 1800311
NCBI-ProteinID: NP_294743
UniProt: Q9RVK8
LinkDB All DBs
Position
1:1031813..1033381
Genome map
AA seq 522 aa AA seqDB search
MTQGSVVDPRPAQVRAALAPQEWDVIVVGGGASGLGSAVEAATRGHSVLLLEGHDYAKGT
SSRSTKLVHGGVRYLAQGNVSLVREALHERGLLRKNAPHLVRDLGFVVPAYDWWAAPFYG
IGLKMYDVLAGKLNLGSSTYLDRDKVLSRVSTYKEKGLRGGILYFDGQFDDARLAVTLLR
TLEDFGGVALNYAPVIGLIKDGEQVRGVRFRDEESGQEHEARAKIVVNATGVWVDDIRRM
EDPTVKPMLSPSQGVHVVVEKKFLPGDSAIMIPRTDDGRVLFAVPWHDHVVIGTTDTPVP
QADFEPHALEEEVEFILRTAGRYMDPAPGRADVLSVYAGLRPLVKNEKSDGAGSTAALSR
DHVIRISKGNLITLTGGKWTTYRRMGEDTINRAEKLGGLPERLTITPGLHLHGWSEDERP
DHWKVYGNDAERVQQLPGADAQLHPDLPYSEAELRWAVRHESARTVEDVLARRTRSILLG
ARASMEAAPRAAAILAEELGKDAAWQAQQVEAYRQVASGYVL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaggttctgttgtcgatccccgtccggcccaggtgcgggccgccctcgccccc
caggaatgggacgtcatcgtcgtggggggcggcgcgtccggtctgggcagcgccgtcgaa
gcggccacgcgcggccacagcgtgctgctgctcgaaggtcacgactacgccaagggcacc
agcagccgctcgaccaagctggtgcatggcggcgtgcgttacctcgcccagggcaacgtg
tcgctggtgcgcgaggcgctgcacgaacgcggcctgctgcgcaagaacgccccgcacctc
gtgcgtgacctcggcttcgtggtgcccgcctacgactggtgggccgcgcccttctacggc
atcggcctgaagatgtacgacgtgctggcgggcaagctcaacctgggcagctcgacttac
ctggaccgcgacaaggtgctgtcgcgcgtctccacctacaaggaaaagggcctgcgcggc
ggcatcctctacttcgacggtcagttcgacgacgcccgccttgccgtgaccctgctgcgc
accctcgaagatttcggcggcgtggccctgaactacgccccggtcatcggcctgatcaag
gacggcgaacaggtgcgcggcgtgcgcttccgtgacgaggaaagtgggcaggaacacgag
gcccgcgccaaaatcgtggtcaacgcgaccggcgtgtgggtggacgacatccgccgcatg
gaagaccccaccgtcaagccgatgctctcgccgagccagggcgtgcacgtcgtcgtcgag
aagaagttcctgccgggcgacagcgccatcatgattccccgcaccgacgacgggcgcgtg
ctgttcgcggtgccctggcatgaccacgtggtcatcggcaccaccgacaccccggtgccg
caggccgacttcgagccgcacgcactggaagaagaagtcgagttcatcctgcgcaccgct
gggcgctacatggaccccgcgcctggccgcgccgacgtgctgagcgtctacgccgggctg
cgtccgctggtcaagaacgagaagtccgacggcgccggctccacggcggccctctcgcgt
gaccacgtcattcgcatttccaagggcaacctgatcaccctgaccggcggcaagtggacc
acctaccgccgcatgggcgaagacaccatcaaccgcgccgaaaaactcggcgggctgccc
gagcgcctgaccatcacccccggcctgcacctgcacggctggagcgaggatgagcgccct
gaccactggaaggtctatggcaacgacgccgagcgcgtgcagcagctccccggcgccgac
gcacagctccaccccgacctgccttatagcgaggccgaactgcgctgggccgtgcgccac
gaaagtgcccgcaccgtcgaggacgtgctggcccgccgcacccgctcgatcctgctcggc
gcccgcgccagcatggaagcggccccccgcgccgccgccatcctcgctgaggaactgggc
aaggacgccgcgtggcaagcgcagcaggtcgaagcgtaccggcaagtcgccagcggctac
gtgctgtaa

DBGET integrated database retrieval system