KEGG   Danio rerio (zebrafish): 406791Help
Entry
406791            CDS       T01004                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    406791 (hk1)
   00051 Fructose and mannose metabolism
    406791 (hk1)
   00052 Galactose metabolism
    406791 (hk1)
   00500 Starch and sucrose metabolism
    406791 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    406791 (hk1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    406791 (hk1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    406791 (hk1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     406791 (hk1)
Membrane trafficking [BR:dre04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    406791 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
LinkDB All DBs
Position
13
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRFSDETLRDIMARFRREMENGLARDTNPTAT
AKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIH
GSRSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCSQSKLDEAVLLTWTKRFKVNGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHMDMVEGDEGRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTRLG
VEPSEDDCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNTPRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPESDVRFLLSESGSGKGAALVTAWAYRLADQERQIAETLEEFRLT
KDQLLEVKKRMRTEIQNGLSKSTQNTATVKMLPTYVRSTPDGSENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGLLVNWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVSGEEGRMCVNMEWGAFGDNGCLDD
IRTKYDDAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGAVSRRAAQLCGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVTFLLSEDGSGKG
AALITAVGCRLRQQEQKS
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggcacagcttctggcctactacttcactgaactgaaggatgaccaggtcaaa
aagattgacaaatacttgtacgccatgcggttctctgacgagacgctgcgcgatattatg
gctcgtttccgacgggaaatggagaacggattggcacgagacaccaacccgacagccacc
gctaaaatgctgcccacctttgtaaggtccattcctgatggatcagagaaaggagatttc
atcgcactggatctgggtggctctaatttccgtattctgcgtgtaaaagtgtctcatgag
aagaaacagacagtgcagatggaaagtcagatttacgagactccagaagacatcatccac
ggcagcagatcacggttgtttgaccatgttgcagaatgtcttggagacttcatggagaaa
caaaaaattaaagacaagaagcttcctgtgggcttcaccttctcatttccttgttcacaa
agcaaactggatgaggctgttttgctgacatggacgaaacgcttcaaggttaatggagta
gagggaatggatgtagtgaagcttctcaataaggccattaaaaaacgtggagattacgaa
gcagatataatggctgttgtcaatgacactgttggaactatgatgacctgcggatttgat
gaccagcgatgtgaagtcggcattatcataggtaccggcactaatgcatgctacatggag
gagctcagacacatggacatggtggagggagatgaaggcaggatgtgtattaatactgaa
tggggggcgtttggagatgacggcacattggaggacatccggactgagtttgacagggag
attgaccgaggatccctcaaccctggcaagcaactgtttgagaagatggtgagtgggatg
tacatgggtgagctggtgaggctgatcctggtcaaaatggctaaagaaggcctgctgttt
gaaggccgcatcacaccagagctgcttacaaaaggaaaaatcgaaaccaagcacgtttct
gcaattgagaagagcaaggaaggactaaccaaagccaaggagattttgacacgcttgggt
gtagagccgtctgaggacgactgcattgctgtgcagcatgtttgtgccattgtctctttt
cgctctgctaatctaattgctgccactttgggtgcaatcctgacacgtctgaaggacaac
aagaacaccccacgtctccgcaccaccgtgggcattgatggctccctatacaagatgcac
ccacagtatgcccgtcggttgcacaaaacagtgcgtcgtctggtgccagagtctgatgtt
cgcttcttgctgtctgagagtggaagtggaaagggagctgcactggtgacagcctgggct
taccgtttggcggaccaggagcgtcaaattgcagaaaccctggaagagttcaggttgacc
aaagaccagctgctagaggtgaaaaagaggatgagaactgagattcagaatggactgagc
aagagcacccaaaacacagccaccgtcaaaatgctgcccacatatgtgcggagtacccct
gatggatcagaaaacggtgactttttggctctggatcttggaggtacaaacttcagggtc
cttttggtaaagattcgcagtggcaagagacgaactgtggagatgcataataaaatttat
gccattcccatagaagtaatgcaaggaaccggagaggagctttttgatcacatcgtgtac
tgcatatctgacttcctggactacatgggaatgaagaatgcccgtctgcctctgggcttt
accttttctttcccctgcagacaaactagtcttgatgcgggactcttggtgaattggacg
aagggctttaaagccacagactgtgaaggtgaagatgttgtcggccttctgagagagggg
atcaagaggagagaggagtttgatttggatgttgtagccatagtaaatgacacagtgggc
acaatgatgacctgcgcatatgaagagcccacgtgtgaggttgggctaatcgcaggaacg
ggcagcaatgcctgctacatggaggaaatgcgaaacatcgagacagtaagtggagaggag
ggcaggatgtgtgtgaatatggagtggggagcatttggagataatggctgtctggatgac
atccggacgaagtatgacgatgctgtggatgacctctccctcaatgccggcaaacaaaag
tatgagaagatgtgcagtggcatgtacctgggtgagattgttcgaaacatcttgatcgac
ttgacgaagcgaggcttcctcttcaggggacagatctctgaaacactgaagaccagaggc
atcttcgaaaccaagttcctgtcccaaattgagagtgaccgtttggcgctactgcaggtc
aggtctattctccagcatctgggtctggacagcacatgcgatgacagtatcatcgtcaag
gaggtttgtggagctgtttctcgtcgagcagctcagctctgtggagcaggaatggctgct
gttgtggataaaatccgggagaaccgtggactggatcatctggacatcactgttggagtg
gatggcaccctgtataagctccatccacatttctctaggataatgcatcagacggtgaag
gagctcgcccccaaatgcaacgtcactttccttctctcagaagacggaagcggtaaaggt
gctgccttgatcaccgccgttgggtgtcgcctccgccagcaagaacagaagagctga

DBGET integrated database retrieval system