KEGG   Danio rerio (zebrafish): 436894Help
Entry
436894            CDS       T01004                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00480  Glutathione metabolism
dre00980  Metabolism of xenobiotics by cytochrome P450
dre00982  Drug metabolism - cytochrome P450
dre00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    436894 (gsto1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    436894 (gsto1)
   00982 Drug metabolism - cytochrome P450
    436894 (gsto1)
   00983 Drug metabolism - other enzymes
    436894 (gsto1)
Enzymes [BR:dre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     436894 (gsto1)
Transporters [BR:dre02000]
 Other Transporters
  Pores ion channels [TC:1]
   436894 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin GST_C_6
Motif
Other DBs
NCBI-GeneID: 436894
NCBI-ProteinID: NP_001002621
ZFIN: ZDB-GENE-040718-365
Ensembl: ENSDARG00000022183
Vega: OTTDARG00000018255
UniProt: Q6DHK5
LinkDB All DBs
Position
13
AA seq 240 aa AA seqDB search
MAASQKCLGKGSPAPGPVPKDHIRLYSMRFCPFAQRTRLVLNAKGIKYDTININLKNKPD
WFLEKNPLGLVPVLETQSGQVIYESPITCEYLDEVYPEKKLLPFDPFERAQQRMLLELFS
KVTPYFYKIPVNRTKGEDVSALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPW
FERLETMNLKHCLDGTPELKKWTERMMEDPTVKATMFSTETYMVFYKSYMEGNPNYDYGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctcagaaatgtcttgggaaaggaagtcctgctcctggtccagtgccaaag
gaccatattcggctctacagcatgagattctgcccgtttgcccaaagaaccagattggtg
ctcaatgccaagggaataaaatacgacaccatcaacatcaatttgaagaacaaacctgac
tggtttctggagaagaatccccttggtttagtgccagtgctggagactcagagtggtcag
gtgatctacgaatctccaatcacctgtgagtacctggacgaggtctatcctgagaagaag
ctgctcccgtttgacccgtttgagagggcgcaacagagaatgctgctggagcttttctca
aaggtgactccctacttctataagatccccgtgaacaggacgaaaggagaggatgtgtct
gcacttgaaacagaacttaaagacaaactctctcagttcaatgagatcctcctcaagaag
aagagcaagttttttggaggggattcaataacaatgattgactacatgatgtggccatgg
tttgagaggctggagacgatgaatctgaagcactgcttggacggcacacctgagctgaag
aagtggaccgagcgcatgatggaggatcccactgttaaagctacgatgtttagcacagaa
acctacatggtcttctacaagtcctacatggagggaaacccaaattatgattacggttta
taa

DBGET integrated database retrieval system