Danio rerio (zebrafish): 447814 Help Entry 447814            CDS       T01004                                  Symbol ppp3r1b Name (RefSeq) calcineurin subunit B type 1b   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism dre  Danio rerio (zebrafish) Pathway dre04010   MAPK signaling pathway dre04020   Calcium signaling pathway dre04114   Oocyte meiosis dre04218   Cellular senescence dre04310   Wnt signaling pathway dre04370   VEGF signaling pathway dre04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:dre00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     447814 (ppp3r1b)    04310 Wnt signaling pathway     447814 (ppp3r1b)    04370 VEGF signaling pathway     447814 (ppp3r1b)    04020 Calcium signaling pathway     447814 (ppp3r1b)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     447814 (ppp3r1b)    04218 Cellular senescence     447814 (ppp3r1b)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     447814 (ppp3r1b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dre01009]     447814 (ppp3r1b) Protein phosphatases and associated proteins [BR:dre01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      447814 (ppp3r1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  447814 NCBI-ProteinID:  NP_001004553 ZFIN:  ZDB-GENE-040912-18 Ensembl:  ENSDARG00000069360 UniProt:  Q66HZ0 LinkDB All DBs Position 1:complement(51557793..51591364) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcgagttatcccttggagatgtgctcacactttgacgctgatgagatt aaaagactaggaaagcggtttaagaaactcgacctggataactcgggctctctcagcgtg gaggagttcatgtctctgcccgaactgcaacagaatccgctggtgcagcgagtcatcgac atattcgacacagatggaaacggagaagtcgactttaaagagttcattgaaggcgtttct cagttcagtgtgaagggcgacaaggagcagaagctccgctttgcgttcaggatttacgac atggacaaagatggctacatctccaacggcgagctgttccaggtgctgaagatgatggtg gggaataacctgaaggacactcaactgcagcagatcgtcgacaaaaccatcatcaacgca gacaaggacggtgacggcaggatatccttcgaggagttctgcgctgttgttggcggttta gacattcataaaaagatggtggtggacgtgtga

DBGET integrated database retrieval system