KEGG   Danio rerio (zebrafish): 559691Help
Entry
559691            CDS       T01004                                 

Gene name
tgm8
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like isoform X2
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     559691 (tgm8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
LinkDB All DBs
Position
6
AA seq 682 aa AA seqDB search
MCSSSSSNTPDQGVRVDLECVKNNTDHHTHEITQERLIIRRGQAFSLKISAENIQQNHIS
ITAETGPGVSEVKHTLFSFSTQSSTNPAQVCSRSESSVSLALVFPSDAPVGRYSVCVKHG
SSSCMNTLTLLFNPWCKDDHVYLPSEAERQEYIMSEQGVLYKGVDEYITSMNWDYGQFEE
DIVDICLKLLDLNPKCLKDPQEDYSARCNPVYVSRVVSAMINCNDDQGVLAGQWGDSYTG
GVPPSRWSSSVEILRRWVKYNCSPVKYGQCWVFAAVMCTVLRCLGIPCRVVTNYQSAHDT
DRNLVVDEYFSDYGVRPKNSQDSVWNFHVWVEAWMRRPDLTEDTLYDGWQVLDPTPQEKS
SGTYCCGPAPVMAILEGHTEVKYDVPFVFAEVNADRVCWLLMTDGSRKKIMSDSRSVGQN
LSTKAVGSSSRLDITDLYKHGEGSAQERAVYTEAVHRLTDLQIPESPPVSVQMRLSLDVP
PLNGADVPLKLFLKGSRAQCVCVNISAQVMRYTGAPAAAVWSHSTDVQLQDTEEKALSFT
LPYSAYGHRMLENNCIKVSAIAREKNNPKDTYLTEKNIILHTPNLSITVSGSPLLDSEMT
ATVQFENPLSSTLQNCSISLSGSGLLKSTEKSSTVQLGPGQRIRLQVSFTPYRLGLKKLM
ATFNSATFKDVQASADVDVRSA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcagcagcagctccaacacaccagaccagggtgtgagagtggatctggagtgt
gtgaagaacaacaccgatcatcacacacacgagatcacacaggagcgtctgatcatccgc
aggggacaggccttcagtctgaaaatcagtgctgagaacatacagcagaaccacatctcc
atcactgctgagaccggccccggtgtgagtgaagtgaagcacacactcttctccttcagc
actcagagctccactaaccccgctcaggtgtgcagccgctctgagtcctccgtcagcctg
gcgctggtgtttccgtctgatgctccagttgggcgatactctgtgtgtgtgaagcacgga
tcctccagctgtatgaacacactgacgctgctcttcaacccctggtgtaaagatgaccat
gtgtatctgccgagtgaagcggagcggcaggagtacatcatgagtgagcagggcgtcctg
tataaaggagtagatgaatacatcaccagcatgaactgggactacggtcagtttgaggag
gacatcgtggacatctgcctgaagctgctggatctgaaccccaagtgtctgaaagaccct
caggaggattattcagctcgctgcaaccctgtatacgtcagccgagtggtcagcgctatg
atcaactgtaatgatgatcagggtgttctggcgggtcagtggggcgactcgtacaccggt
ggggttcctccgtcccgctggagcagcagtgtggagattctgcgccgctgggttaaatac
aactgcagtcctgtcaaatacggccagtgctgggtgtttgcagctgtcatgtgcacagtg
ctgcggtgtctgggtatcccgtgtcgtgtggtcaccaactatcagtctgctcacgacact
gaccgtaacctcgtggtggatgaatacttcagtgattacggcgttcggcccaagaacagc
caggacagtgtgtggaacttccatgtgtgggtggaggcctggatgaggagacccgacctg
acagaggacacactgtatgacggctggcaggtgctggatcctacaccacaggagaagagc
tcaggcacgtactgctgtggtccggcaccagtcatggctatcctggagggtcacacagag
gtcaagtatgacgtgccctttgtgtttgcggaggtcaacgctgatcgagtgtgctggctg
ctgatgacggacgggtccaggaagaagatcatgtcagacagcagaagtgtgggtcagaac
ctcagcactaaagctgtgggcagcagcagccggctggacatcactgacctctacaaacac
ggcgagggctcagcgcaggagagagccgtctacactgaagctgtgcacagactgactgac
ctgcagatccccgagtctcctccagtcagtgttcagatgaggctcagtctggacgtcccg
ccgctgaacggagctgatgttccgctgaagctcttcctgaagggcagcagagcgcagtgt
gtgtgtgtaaacatcagcgcgcaggtcatgaggtacactggagccccggcggctgcagtc
tggagccacagcactgatgtccagctgcaggacactgaggagaaagctctgtccttcaca
ctgccgtactctgcatacggacacagaatgctggaaaacaactgcattaaagtctccgcc
atcgctagagagaagaacaacccaaaggacacatatctgaccgagaaaaacatcattctg
cacactccaaacctcagcatcactgtaagcggttctcctctgctggacagtgagatgacg
gctactgtacagtttgagaatcctctctcctcaacgctgcagaactgctccatcagtctg
agcggcagtggtctgctcaaaagcacagagaagtccagtacggtgcagctcggcccggga
cagaggatcagactgcaggtcagcttcacaccctacagactgggactcaagaagctgatg
gccaccttcaacagcgccaccttcaaggacgttcaggccagtgcggatgtcgatgtgaga
tcagcgtga

DBGET integrated database retrieval system