KEGG   Danio rerio (zebrafish): 561287Help
Entry
561287            CDS       T01004                                 

Gene name
f13a1b
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     561287 (f13a1b)
Cell adhesion molecules and their ligands [BR:dre04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     561287 (f13a1b)
   VLA-9
     561287 (f13a1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
LinkDB All DBs
Position
7
AA seq 742 aa AA seqDB search
MADQVAPENPTPAAAPTVRPKQRVSHRGRSAGGRASSNQQEGKVEEFEPFMLMPRGPPPL
TEYLDIFDVDVLKQPNEVNKQAHHTHLYSSNFLIVRRAQEFQIKITFNRPYKPAEDKFAV
EFVIGPVPQYSKGTYIPVFPTAKRQSVWSGRVIESSENVVTMGITPSAECIVGKYMTYIG
VETPYGIRRTRRDPNTDIYILFNPWSPADPVFLDDEEEREECVMNELGIIYHGAYDDVSE
RAWNYGQFEFGVLDACLFVMDKADMPLSNRGDVVKVTRVASAMLNSRDDDGVLVGNWSGD
YMYGVPPTSWTGSVEILLDHANSSGTPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNFFSA
HDNDGNLKMDIILDENGKLDRNRTKDSIWNYHCWNECYMARPDLPSGFGGWQVVDATPQE
TSDGMFRCGPASVAAIKHGQICYPFDAPFVFAEVNSDVVFYRRRKDGILEVVKVNQTHVG
RMVLTKAVLHSGRRDITNQYKFPEGSPEERRVLEKAEEFGCQREKSSPALSDVDVEIHSL
DVNVGENFDVTLQFTNRSDQRRTADVYITGTVVYYTGVPSGEVVFKTPKVKLEPMQSKEE
KVLVRSEDYMNKLVEQRNIHFIATGKIKETGQIITAMKVIAMHHPKLTVKVTGSPRVSEE
MYVSVEFTNPFKFSLENVDLRVEGPGVLPFKYKQYSVIAPGTSITWTEAFSPRRAGSTKV
FAKLDCAALRQVYGETELTVQE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaagtggctccagagaacccgacccctgctgctgcacccaccgttcggccc
aaacagcgggtgtcccaccgtggacgcagcgcaggaggcagagccagctccaatcaacaa
gagggcaaggtggaggagtttgagcccttcatgctgatgcccagaggacctccaccactc
actgagtatctggatatctttgatgtggatgtgctcaaacagcctaatgaagtgaataaa
caggctcatcacacacacctttactccagcaacttcctcatcgtgcgccgagctcaagag
tttcagatcaagatcaccttcaatcgaccctacaaaccggctgaagacaagtttgcggtt
gagtttgttataggaccggttcctcagtacagtaaaggcacctacattcccgtcttcccc
actgcgaagcggcagagcgtctggagcggccgggtcatcgaaagcagtgaaaatgtggtc
acgatgggcatcactccctcagcagagtgcattgtgggaaaatacatgacctacatcggt
gtggagacaccgtacggcatccgcaggaccaggagagacccaaacactgacatctatatc
cttttcaacccgtggtcaccagctgatccggtgtttctggatgacgaggaggaacgtgag
gagtgtgtaatgaatgaactcgggatcatctatcatggagcatatgatgatgtgtctgaa
cgcgcctggaactacggacagtttgagtttggagttctggatgcatgtctgttcgtcatg
gataaagctgatatgccgctgtcaaaccgaggtgatgtcgttaaagtgactcgcgtcgct
tcagcaatgctgaactctcgtgatgatgacggagtgttggtgggaaactggagtggggat
tacatgtacggagtgccgccgacgtcctggacgggcagcgttgagatcctattggaccac
gccaacagtagtggaactccagtctgctatgctcagtgctgggtctacgccgctgtcttc
aacaccttcctgcgatgtctcgggatccccagcagagtcgtgaccaacttcttttctgct
cacgacaatgacggcaacctgaagatggacataatcctggatgaaaatgggaaactggac
cggaaccgcaccaaagactccatctggaattatcattgctggaacgagtgctacatggcc
aggcctgatctgccttcagggtttggaggttggcaggttgtggacgcaacgccacaggag
accagcgatggtatgtttaggtgtggacctgcgtctgtagctgccataaaacatggtcag
atctgctacccgtttgatgccccctttgtgtttgcagaggtgaacagtgacgtggtcttt
tatcgtagacgtaaagacggtattctggaagtcgtgaaggtgaatcagactcatgtgggc
cggatggtgctgaccaaagctgtgctgcacagtggacgtcgagacattacaaaccagtac
aagttccctgaagggagcccggaggagcggcgtgtgctggagaaagctgaggagttcggc
tgtcagcgggagaaatcctctcctgctctgagcgatgtggacgtggagatccacagtctg
gatgttaatgtaggggaaaactttgatgtcactctgcagttcaccaaccgcagtgaccag
cgccgcacggcagacgtctacatcaccgggacagtggtgtattatactggagtcccgagc
ggagaggtcgtgtttaagacacctaaagtcaaactagagccaatgcagagtaaagaggag
aaagtgctggtccgcagcgaggactacatgaacaaactggtggagcagagaaacatccac
ttcatcgctacagggaagattaaagagacgggacagatcatcacagccatgaaagtcatc
gcaatgcaccatcccaaactcaccgtcaaggtcacaggctctccgagggtgagtgaggaa
atgtacgtgtctgttgagttcacaaaccctttcaagttcagtctggagaacgtggatctg
cgtgtggagggtcccggagtcctgcccttcaaatacaagcagtacagtgtgattgctcca
ggcacctctataacgtggactgaggcgttcagccctcgacgggccggatctactaaagtg
tttgccaaactggactgtgctgctctcagacaggtgtacggagagacggagctcactgtc
caagaatga

DBGET integrated database retrieval system