KEGG   Danio rerio (zebrafish): 572849Help
Entry
572849            CDS       T01004                                 

Gene name
suv420h1
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    572849 (suv420h1)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     572849 (suv420h1)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     572849 (suv420h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
18
AA seq 808 aa AA seqDB search
MGESKNMVLNGRRHGRKFSSNQPVSKSRLQNTQRSHLRQNKGSPSVRRCSRRCGGAPPEA
ERRHVPSSGMTAKELCEYDDLSTSLILDPYLGFQTHKMNTRFRPIKGRQRELREIIELFK
KHDNLEKAFQALTSGDWTRHHFLNKTKSQEKLFKAHVFVYLRMFASDSGFEILSCNRYSS
EQNGAKIVATKDWKRNDKIEHLVGCIAELSPSEERMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEFCECYTCE
RRGTGAFKSKPGLPVEAPVINSKYGLRETDKRLNRLKKLGESCRNSDSQSVSSNAEADSQ
EPTTVQTSLRKRTSQSCVKKHGEAKAVTRQTLSSTPSSTSSSKRSQANISSLPKRLKSKP
TQTLSKGRRRCRGLWTKGSSRVSASGNLKESSRRDTDRRRSASKGSVARSSENNRSSSKG
ASPCKDSTLCPYRTRRSTRTSLGAQGAEGTEASNHPASPSIVLKSEPGEFIPVTPGHQMS
TPSLDSSCPKKGTCPRRRRTVKQEDSYGESFVQEGVPDLRHAVRAADVADCGKVVLGLPD
RHQHYNGSSKSSKALRRGKGKKKRQITRYDAQLILQNNSGIPKITLRRRRDSSSSKNEPR
ETSSSSSSKISIKFSKEHEKDRSSSYVAKLNNGFSHGPHSSSTKLKIQLKREEDPASLHR
TYPEDVTLGIVQRDAADVLDHKAAAQVGQDMEVESMSSEDDDDDYFDNEDDFIPLPPAKR
LRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatccaagaacatggtgctgaatggcaggagacatggcagaaagttctccagt
aatcagcccgtaagcaaatccaggctgcaaaacacacagagatcccatcttcgccagaac
aaaggctccccgagtgtcagaagatgcagtcgacgttgtggtggggcgcccccggaggca
gaaaggcgtcatgttccttcatcgggaatgactgccaaggagttgtgcgagtatgatgat
ctgagcaccagtctgatcctggatccataccttggctttcagacccacaagatgaacacc
aggtttcgaccaatcaaaggccggcagagggagctgagggagatcattgagcttttcaag
aagcatgacaacctggagaaagcttttcaggctctgacatctggagactggaccagacat
cattttctcaacaagaccaagtcccaggagaagctcttcaaagcacatgtgtttgtttac
cttcgcatgtttgcttcagacagcggctttgagatcctttcttgcaatcgctactcctct
gagcaaaatggagccaaaattgtagcaacaaaagattggaaaaggaatgataaaatcgaa
catcttgtgggctgtattgctgagttgtctcccagtgaagagcggatgttgcttcgacat
ggagagaatgatttcagtgtcatgtactcaacacgcaaaaactgcgcacagctctggctg
ggacctgcagcttttattaaccacgattgcaggccaaactgcaagtttgtgtcaacaggc
cgagataccgcctgtgtaaaggttctacgggacattgaaccaggggaagagatctcctgc
tactatggagatggattctttggagaaaacaatgaattctgtgaatgctatacttgtgaa
aggcgtggcactggagcttttaaatcgaaaccagggttacctgttgaagctccagtgatc
aatagcaagtacggcctcagagagacagacaagcgtctgaacagactgaagaagctgggg
gaaagttgcaggaactctgacagccagtctgtcagttccaatgcagaggcagactctcag
gaaccaaccactgtacaaacatcattacgtaagagaacttcacagtcctgtgtcaaaaag
cacggagaagctaaggctgtaacaaggcaaactctgtcaagcactccttcttctacctca
tcctctaaacgaagtcaagcgaatatttcaagtttaccaaagagacttaagtcaaagccc
acacagactttgtctaaaggaagacgacgctgtcgaggcctatggacgaaaggttctagc
cgagtgagcgctagcggaaatctcaaagagtcctctagacgagacacagacagacgtaga
tctgcaagcaaaggcagtgttgcgcgttcatcagaaaacaatcggagctcttcaaagggt
gcttccccatgcaaggacagcacactttgcccttacagaactcgtaggtccacgaggact
tctcttggtgctcagggggctgaaggcacagaggcttcaaaccacccggcgagcccgagc
atcgtcctcaagtcagagcctggagagttcattcctgtgacacctgggcaccagatgagc
actcctagtttggactccagctgtcccaagaaagggacttgtcctagacgcagaaggaca
gtaaaacaggaagactcctacggcgagtccttcgtccaggagggcgttccagatctgcgg
cacgcggttcgggctgcagatgtagcagactgtgggaaggtggtgctcggccttccagac
cgccaccagcactacaacggctcctctaagagcagcaaggccctccgtcgagggaaaggc
aagaagaagcgacagatcacacgctatgacgctcagctgattctgcagaataactcaggc
atccccaagataacactacgccggcgtcgagacagcagcagcagcaagaatgagcccaga
gagaccagctcctcaagctcctccaaaatcagcatcaagttcagcaaggagcacgagaag
gaccggagcagctcgtacgtagccaaactcaacaacggcttcagccacggaccgcacagc
agctccaccaagctcaagatccagctgaagcgggaggaagaccccgccagcttgcaccgc
acttacccggaggacgtcaccttgggcatcgtgcaacgagacgctgcggacgtcctggat
cacaaggcagccgctcaggtaggtcaggacatggaagtggaatcgatgtcgtcagaggac
gacgacgatgactactttgataacgaggatgatttcatcccgctcccaccagcaaaacgc
ctgcgcctcatcgtgggcaaagattccatagacattgacatttcctccagacggcgagaa
gatcagtcgctcagactcaacgcataa

DBGET integrated database retrieval system