KEGG   Danio rerio (zebrafish): 794199Help
Entry
794199            CDS       T01004                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    794199 (setd2)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     794199 (setd2)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     794199 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16
AA seq 2737 aa AA seqDB search
MDALLNPELREDVKDCSIKVENFPKQVIFKGLAPRVVLTNHLLMKGNKTKVNLEEQGRQK
VSFSLTQTKKPRQNVFLPPPSPEKSASEHSSTSQAGPVPVSVQAGQTYETKNVDTNTPAV
GETQTAPTVSFSLRSRHVLGKMHFKKQILSSTVVGDKSTVSTASAEISEPVVPSDKITSS
AKVETENSLQQSHKNSVVDGSSEKVSKEENPQEKIASCLKGPDSSHIGKEDTDSSIISEH
EESRKSKQCSDSKLAGLETDGQSTRTSSSQKSNDRRNKTKSESHSNEVKRSSNSKTELDK
SRTDRKDEEKGIRHSKSDRDSRHMSSRSSRSDRDRRRTKSRSRSRSRGSRTSSYSRSERS
RSERQSRTDRSHYHESERRFHRSSPHRERRSSRSRTDGRSRDSSDSEDDHRRTRTRGSDS
SRSSTYSSSQKDSKSSTHSRSHRDSKPTDCSRSSESDKRAQHSKSESNRRSSSEIDAVHK
KSSARTKLEVNDKISNSNLTTSSRTSEKKIHKTSSDSDEEHRRKRQSQGSDRSPRSGTSS
SRKNDLVDHNSFNIGTGTERQSTDRLNTNAKDSQLVFVTVTSQKESSNIDDQCTPPKSKN
SSQQMHEATHKVNLCETNKKAEHQPSNQDLSSLEKCTNVPESKKTTERLTESISITSGKL
EVRSPTEVDEPGMKVTVPIQSEVLTVGQTESICVGPAPSEHTMGSLTDSLSVKELPPEGS
LILNTKSDESSLIISQISTPVTLTVQPCEKDSEQNIGSPEQPNTGISKKDASAKKSRWDI
VGQVTSEYQSPAKLVNPDVKKVMLAQKIEFSDTTPDNCSQKLDPEVPSEKSVEVHARDTT
AAESHQEISSFTSNFGTKGTHDELQKTVEIPQSTSALVVSDFQPSKEKVNVDKTKPEIQD
PDSLNHDGKCHSDDSESEESDSDSDDGRVSLKRLHSVVVVPKNSTIALETNDKAEPAPAS
SLFSGNQQTDTHESINKEFPYGFNNQSTLKESSAALYKGSAQAACQSPNVKGVSYQSQSN
MVDSTSHLEVMSAHVDKNWSAQERPNISGQINQEYVQNFEKTCEKPETDHHQYHGRPDSW
NGRKGDFSVGRGDSLVWDFNQSEQPSSTFQQPDSSYSTPQPLFDSVHREDPWAQPAISKT
SRTVNTHVPFQYHDLVHQIHPDSLTNDHDDDREGRILGIKQASLLSAGLPGPSPFVQAPE
ISSNCSFTTESQNISEAPRDDNQKPHRGRGPPKKRRQEFESESDNEAEAGLSKRECFDES
SRPLKDAKESFHQIQEVQRPLLSLKEFSDPFVWRDKAKQKKMPPYFDLIEENLYLTERKK
NKSHRDIKRMQCECAILSKEERARGILACGEDCLNRLLMIECSSRCLNGAYCSNRRFQMK
QHADYEVILTESKGWGLRAAKDLQPNTFVLEYCGEVLDHREFKARVKEYARNKNIHYYFM
ALKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRIGFFTTKAVTAGTELTFDYQ
FQRYGKEAQKCFCGAPSCRGLIGGETRVSVRAAGGKKQRERSRKKDTDSALTTLDEELEA
LQENGEGLCGEKEVISLCRLMVRVETMEQRLTCLKLIQNTQNPLCLKQFLDHHGLSLLWI
FMVELSEAKTNSVNNIKLQLEIMKALSVLPISTKNMLEESRVLQFIQRWAQSRSLSQPAE
QDGYSSESTSRAQTPLNTPDGPPAKLATELDGDTPKRAVYRRLKIISENSLDSALSDASK
ASDGKEEEDEEEEEMEDEPSKLESTTERKIKVESTEAPPVSQAELEVELKQEAPETVEIP
RLMPEAVGSEGETLETQEPEEKLLCTPEGQLKDEKTVEETKSDEPSENQTESAAVKEDPL
VTDTTSAADISNDVVADAETPVTETQVENASSEQSTSEEDASCSTAEITSAQPAEVIIEG
ISSDSAAIVIKSTPKESPSVSVKTPPTGSDVVSNGNAPSEAVFAPSEAVAAPLEAAVAPS
EAVASFPEAVASLPETVAAPAEAVDEPAEAVADPAEAVADPAEAVADPAEAVAEPAEAVA
APAEAVAAPPEAVAAPPEAVAAPVSADVSALAIVPVPAEGAAVGTPSQDEEEGVSDVESE
RSQEPQIRASDISDMAARLLDSWKDLKEVYRIPKKSQVEKESNDRSRDRESLMTPRTSSS
SRERERERDKERDRDRDRDWEREREWDRDRERDRDGERPTLRSADRKRRRGSTSPLPPPA
YERSRRNDDRYELSSSSKKKLHTKEARTKLSTEERRKLFEQEVAQREAQKQQQQQLQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQTLAFNPLAYTSSPNFMNYPPG
YPIQTYVDPTNPNAGKVLLPTPPVEPICVTPAAGTFEQPPALDLGIASPSSTTTQAGPAS
SLAHIPAPLELSSGTQTQFVQPAVPAQDPSVAVLSVPAQAASPQIPSQQGYTTLWDPNTQ
QAVTVQTQPTQQYSTTSQPQAAIYYQGQPCQTIYSIPAGYPQTNPPVIQAYTEPAANYLH
SQQVYTQGGTVTTIVTSQPVQQEMIVPNNIIDLPPPSPPKPKTIILPPSWKVARDPEGRI
YYYHIITRQTQWDPPSWDGTTEEASVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELA
KKSKEVFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNP
EDLECNENVKHKTKEYIKKYMQKFGSVYRPKEDTELD
NT seq 8214 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctgttgaatcctgagctcagagaagatgtaaaagattgttcgatcaaggtt
gaaaacttccctaagcaagtcatattcaaaggccttgcacctagggtcgtattgacaaac
catcttctgatgaaaggaaacaagactaaagtaaaccttgaggaacagggtcgacagaag
gtctccttcagcttaacgcagacaaagaaaccacgtcaaaatgtgtttctaccaccacca
agccctgagaaatctgcaagtgaacattcttctacatcacaagctggacctgtacctgtt
tccgttcaagcaggacaaacctatgaaactaagaatgttgacacaaatactccagcagtt
ggggagacccaaacagcccccacagtatccttttctctcagatcaaggcatgttcttgga
aagatgcattttaagaaacagattctcagcagtacagttgttggggataaatccacggtc
agcactgcctcagcagagatatcagagccagttgtcccatctgataaaattacatcttcc
gcaaaggttgaaactgaaaactccttgcagcaatctcacaagaactctgttgttgatggt
tcttctgaaaaggttagcaaagaggaaaatcctcaggagaaaatagcctcatgccttaaa
ggtcctgattcttcccatattgggaaggaagatacagattcttccattatttctgagcat
gaggaaagcagaaaatcaaaacagtgttcagacagcaagcttgcaggtttagaaactgat
gggcaatcaactagaacatcatctagccagaaatctaatgaccgcagaaacaaaacaaaa
tcagaaagccatagtaatgaagtgaaaagatcatccaattccaaaacagagttagacaaa
tcaaggactgataggaaagatgaagaaaaggggataaggcattcaaagtctgatcgtgac
tctaggcacatgtcttcaagatcttctcgatctgacagagatagaagaaggaccaaaagt
cggtcacggtctagatctcgaggctctcgaactagttcttattccagatctgaaagatca
agaagtgagagacagtcaaggacagataggtcacattatcatgaatctgagcggaggttc
catagaagttctcctcatcgggaaaggagaagctcacgttctcgaactgatggcaggtct
cgtgacagctctgactcggaggatgaccaccgtcgaacaaggactcgtggtagtgactca
agccgatcatccacttactctagctcacaaaaagactcaaaatcatccactcactctaga
tctcacagggactcaaaacctacagattgttctcggtcctctgagtcagataaaagagca
caacattcaaaatcggaatccaatagaaggagctcttctgaaatagatgcagttcacaag
aaatccagtgcccgcacaaaattggaggttaatgataaaatctcaaattctaacctaact
acctcatcccgaacatctgagaaaaagatccataaaaccagctctgactctgatgaggag
cacagaagaaaacgtcagtcacaaggatcagacaggtcacctaggtctgggacttcatct
tccagaaaaaacgatttagtggatcacaatagttttaatattggtactggaacagaaaga
caatcaacagacagattaaatactaacgcaaaggactcgcaattagtctttgttacagtt
acttctcagaaggaaagcagcaacattgatgatcagtgtactccgcctaaatctaaaaac
agttctcaacagatgcatgaagctacccacaaagttaatttgtgtgaaacaaataaaaaa
gcagagcatcaaccttcaaaccaagatcttagtagtttagaaaagtgcacaaatgttcct
gaaagtaaaaaaacaactgaaagattgacggaatctatttccataacaagtggaaaactt
gaagttagaagtcccactgaggttgatgaacctggaatgaaagtcacagttccaatccaa
agtgaagttctgacagtaggacagactgaatcaatttgtgtaggccccgctcccagtgaa
catactatgggatcattgacagactctctttctgtgaaagaattaccacctgaaggaagc
ttgattttaaacactaagtcggatgagtcatcactaatcattagtcaaatcagtacgcct
gtcacactgactgttcaaccatgtgaaaaggattctgaacagaatattgggagtcctgaa
caacctaatactgggatttccaaaaaggatgctagtgctaaaaaatctagatgggacatt
gttggtcaagtcacttcagaatatcaaagccctgcgaaattagtgaatccagatgtgaaa
aaagtaatgttagctcagaaaatagagttcagtgatactacccctgataattgtagtcag
aaactggacccagaagtaccatctgaaaagtcggtagaagttcatgcaagagacaccacc
gcagctgaatctcatcaagaaataagttctttcacatctaattttggaactaaaggtacc
catgatgaacttcaaaaaactgttgaaattcctcaatcaacaagtgccctggttgttagt
gattttcagcctagtaaagagaaagtcaatgtagacaaaactaaacctgaaattcaagac
cctgattccttaaatcatgatggaaaatgtcacagtgatgatagtgagagtgaagaatca
gattctgattcagatgatggacgggtctccctaaagaggttgcactctgtagtggttgtg
ccaaaaaattcaaccattgctcttgaaacaaatgacaaggctgaacccgcccctgcttcc
tcgttgttttctgggaatcagcaaactgatacacatgaaagcattaataaagaatttcct
tacggatttaacaatcagtcaacactcaaagagtcatcagctgcactttataagggcagt
gcacaagctgcatgtcaaagtccaaatgttaaaggtgtctcctatcaatcgcagagcaac
atggttgacagcaccagccatttagaggtcatgagtgcccatgtggacaagaactggagt
gctcaagaaagaccaaatatctctggccagataaaccaagaatatgttcagaattttgag
aagacttgcgagaaacctgaaacggatcaccatcagtaccatgggagaccagatagctgg
aacggaaggaaaggtgacttcagtgttgggaggggtgacagcttggtctgggacttcaac
cagtcagaacagcccagcagcacatttcagcaaccggacagcagttatagtacacctcag
ccactgtttgatagtgttcacagagaagatccatgggcccagcctgccatctctaaaacc
agcaggacagtcaacacgcatgtgccttttcagtatcatgatttagttcaccagattcat
ccagactctcttactaatgaccatgatgatgaccgtgagggaaggattttgggaattaaa
caagcatcattattatctgctggcctaccaggaccatccccatttgttcaagcgcctgag
ataagtagcaactgcagcttcacaacagaaagtcagaacatctcggaagcacctagagat
gacaaccaaaagcctcatcgaggaaggggcccacctaagaagagacgccaagagtttgaa
tctgaatcagataatgaggcagaggcaggcctgagtaaaagggagtgttttgatgagagc
tcaaggcctttgaaagatgctaaggagtctttccatcaaattcaagaggttcagcgacca
cttctcagtctgaaagaattttcggatccatttgtgtggagggataaagccaagcagaaa
aaaatgcctccctactttgaccttatcgaagaaaatttgtatttaactgaacgaaagaag
aataaatctcatcgagacattaagcgtatgcagtgtgagtgtgctatcctttcaaaagaa
gagcgagcccgaggaatactggcatgtggggaagattgcctgaatcgcttgttgatgatt
gaatgctcttccaggtgtttaaatggagcatactgctccaaccggcgcttccagatgaaa
cagcatgcagactatgaggttattttgactgagagcaaaggatggggtttacgagcagct
aaagacctccagccgaacaccttcgttttagagtactgtggagaggttttggatcaccgg
gaatttaaggcacgcgtgaaagagtatgctcgaaacaagaacattcactattatttcatg
gctttgaaaaataatgagataattgatgctactctaaaagggaactgctctcgtttcatg
aaccacagctgtgaacccaattgtgaaactcagaaatggactgttaacggccagctcaga
atcggcttcttcactaccaaagctgtaacagctggaacggagctcacttttgattatcag
tttcaaagatacggtaaagaggctcagaagtgcttctgtggagctcctagctgtcgcggt
ttaattggtggcgagactcgggtcagtgttcgagcagcaggtggaaaaaaacagagggaa
cgctcacggaagaaagacactgacagtgcactaaccacgttagatgaggagttggaggct
ctgcaggagaatggagaaggcttatgtggagagaaggaggtgatctcactttgcagactc
atggtgcgagtggagacgatggagcagcgactcacctgccttaaactcatccagaatacg
cagaatcccttgtgcttgaagcagtttttggatcaccacggtctctcgttgctgtggata
tttatggttgaactttctgaggctaagaccaactctgtaaacaacattaaacttcaactg
gagataatgaaagctctatcagtgcttcccatctcaaccaagaacatgctggaggagagc
cgagtgctgcagtttatccaacgctgggctcaaagccggtcactcagccaaccggcagaa
caggacggctactctagtgaaagcacatcacgtgcccaaacacctctcaacacccctgac
ggtccaccagccaagctggccactgagctggatggggacactcccaaaagagcagtgtac
cgtagattaaagatcattagtgaaaacagtctggacagtgccctgtctgatgctagtaaa
gcctccgatggaaaagaagaagaggatgaagaagaggaagagatggaggatgagccttca
aaattagagagcacaacagaaaggaagataaaagtagaaagcaccgaagcacctcctgtg
agtcaagctgagcttgaggtcgaattgaaacaggaagcccctgaaacagtagaaatccca
cgtttaatgccagaggctgttggcagtgagggagagacacttgaaactcaagaacctgaa
gaaaaactcctctgtacgcctgaagggcaactaaaggatgagaagactgtggaagagact
aagagtgatgagccgtcagagaatcagacagagtcagctgcagttaaagaagacccttta
gtcacagacaccacatctgcagcagacattagtaatgatgtagttgctgatgcagaaacc
cctgtcacggagacacaggtggagaatgcatcctctgaacagtctacctctgaagaggac
gcaagttgcagcactgcagaaatcacttccgcacaaccagcagaagtcataatagagggc
atatcttctgattctgcagctattgtaataaaaagcacacccaaagagtctccatctgtt
tctgtaaagacccctccaactggttctgatgtggtttctaatggaaacgcaccttcagag
gctgtttttgcaccttcagaggctgttgctgcacctttagaagctgctgttgccccttca
gaggctgttgcttcctttcctgaggctgttgcttcccttcctgagactgttgctgcacct
gcagaggctgttgatgaacctgcggaggctgttgctgatcctgcggaggctgttgctgat
cctgcggaggctgttgctgatcctgcggaggctgttgctgaacctgcggaagctgttgct
gcacctgcggaggctgttgctgctcctccagaggctgttgctgctcctccagaggctgtt
gcagcacctgtctctgctgatgtgtcagctctggctattgtgcctgttccagcagagggt
gctgcagtcgggacaccctctcaagatgaggaggaaggggtttctgatgttgagagtgaa
cgcagtcaggagccacaaattcgggcttctgatatcagtgacatggctgctcggctgctg
gacagttggaaagacttaaaggaggtttacagaataccgaaaaagagccaggttgaaaaa
gagtcaaatgatcgcagtcgtgatcgggaatccttgatgacccctcgcacatcttcgagc
agtcgagagagagaacgagaaagagacaaggagcgtgatcgtgatcgggacagagactgg
gagcgtgaacgagaatgggatcgggatagggaaagggacagggatggagaaaggccaacc
cttcgcagtgcagataggaaaagacgacgaggatccacctcccctctgccaccaccagca
tatgagaggagccgcaggaatgatgaccgttatgaactgtccagcagtagcaagaagaaa
ctccacaccaaagaagctcgtactaagctgtctacggaggaacgacgtaagctctttgag
caagaagtggctcaacgtgaggcacagaaacaacaacagcagcagttgcagcagcagcag
caacaacaacaacaacaacaacaacagcagcagcagcagcagcaacaacaacaacaacaa
caacaacaacagcaacagcaacaacaacaacaacagcagcagcagcagcaattacaaaca
cttgcatttaatcccctggcctacacctctagtccgaacttcatgaactacccgcctgga
taccctattcagacctatgtagatcccaccaatcccaatgctggaaaagtgctccttccc
acccctcctgtagagcctatttgcgtcactccagctgctggtacatttgaacaaccacct
gctcttgatcttggtatagcttcaccatcgtccaccaccacccaggctggacctgcctcc
agcttggcacacattcctgcccctctggagctttcttctggcacacaaactcagtttgtt
cagcctgccgtgccagcgcaggatccgagtgtagctgttctgtcagtgcccgcacaagca
gccagccctcagatcccgagtcagcagggctacaccacgctctgggaccccaacacacag
caggcggtgacggtgcagacgcagccaacacagcagtactcaaccacgtcacagcctcaa
gctgctatctactatcagggccagccctgccagaccatctacagcattcctgcaggctac
ccgcaaaccaaccctcctgtcatacaggcatacacggaaccagccgccaactacctgcac
agccagcaggtgtacacgcaaggaggaacagtcaccaccatcgtcacatctcagccagtt
cagcaggaaatgattgtacccaacaacatcattgacctgccgcctccatcccctcccaaa
cctaaaaccattatcctgcctcccagctggaaagtggcgcgagacccagagggcagaata
tattactaccacatcatcaccaggcaaacgcagtgggatcctcccagctgggatgggacg
acagaggaagctagtgttgaacacgaggcagagatggacctcgggacgcctacgtatgat
gaaaatccctccaagttctctacaaagaccgccgaggcagacacgtccagtgagctggcc
aaaaaaagcaaagaagtcttccgtaaggagatgtcgcagtttattgtgcaatgccttaat
ccataccgcaagccggactgcaagctgggccgcataagtaacacagaagacttcaaacat
cttgctagaaagctgactcacggagtgatgaacaaggaactgaagtcttgcaagaacccc
gaagatctggaatgcaatgagaacgtcaaacacaagaccaaggagtacatcaagaagtat
atgcagaagttcggctcagtgtacaggcccaaggaagacacagagttggactaa

DBGET integrated database retrieval system