Desmodus rotundus (common vampire bat): 112308618 Help Entry 112308618         CDS       T05907                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04015   Rap1 signaling pathway dro04810   Regulation of actin cytoskeleton dro05014   Amyotrophic lateral sclerosis dro05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112308618 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112308618 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112308618 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112308618 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dro04131]     112308618 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:dro04812]     112308618 (PFN1)    04147 Exosome [BR:dro04147]     112308618 (PFN1) Membrane trafficking [BR:dro04131]  Others   Actin-binding proteins    Others     112308618 (PFN1) Cytoskeleton proteins [BR:dro04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112308618 (PFN1) Exosome [BR:dro04147]  Exosomal proteins   Proteins found in most exosomes    112308618 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112308618 NCBI-ProteinID:  XP_024420690 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVAVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgctgtccctgggaaaaccttc gtcaacatcacgccagctgaggttgctgtccttgttggcaaagaccggtcaagttttttc gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggggaatttaccatggatcttcgtaccaagagcaccggcggagctcccaccttcaac attactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgctcccagtac tga

DBGET integrated database retrieval system