Desmodus rotundus (common vampire bat): 112317202 Help Entry 112317202         CDS       T05907                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro01523   Antifolate resistance dro04010   MAPK signaling pathway dro04014   Ras signaling pathway dro04024   cAMP signaling pathway dro04062   Chemokine signaling pathway dro04064   NF-kappa B signaling pathway dro04066   HIF-1 signaling pathway dro04071   Sphingolipid signaling pathway dro04137   Mitophagy - animal dro04151   PI3K-Akt signaling pathway dro04210   Apoptosis dro04211   Longevity regulating pathway dro04218   Cellular senescence dro04380   Osteoclast differentiation dro04613   Neutrophil extracellular trap formation dro04620   Toll-like receptor signaling pathway dro04621   NOD-like receptor signaling pathway dro04622   RIG-I-like receptor signaling pathway dro04623   Cytosolic DNA-sensing pathway dro04625   C-type lectin receptor signaling pathway dro04657   IL-17 signaling pathway dro04658   Th1 and Th2 cell differentiation dro04659   Th17 cell differentiation dro04660   T cell receptor signaling pathway dro04662   B cell receptor signaling pathway dro04668   TNF signaling pathway dro04722   Neurotrophin signaling pathway dro04917   Prolactin signaling pathway dro04920   Adipocytokine signaling pathway dro04926   Relaxin signaling pathway dro04931   Insulin resistance dro04932   Non-alcoholic fatty liver disease dro04933   AGE-RAGE signaling pathway in diabetic complications dro04936   Alcoholic liver disease dro05010   Alzheimer disease dro05022   Pathways of neurodegeneration - multiple diseases dro05030   Cocaine addiction dro05132   Salmonella infection dro05133   Pertussis dro05134   Legionellosis dro05135   Yersinia infection dro05140   Leishmaniasis dro05142   Chagas disease dro05145   Toxoplasmosis dro05146   Amoebiasis dro05152   Tuberculosis dro05160   Hepatitis C dro05161   Hepatitis B dro05162   Measles dro05163   Human cytomegalovirus infection dro05164   Influenza A dro05165   Human papillomavirus infection dro05166   Human T-cell leukemia virus 1 infection dro05167   Kaposi sarcoma-associated herpesvirus infection dro05168   Herpes simplex virus 1 infection dro05169   Epstein-Barr virus infection dro05170   Human immunodeficiency virus 1 infection dro05171   Coronavirus disease - COVID-19 dro05200   Pathways in cancer dro05202   Transcriptional misregulation in cancer dro05203   Viral carcinogenesis dro05207   Chemical carcinogenesis - receptor activation dro05208   Chemical carcinogenesis - reactive oxygen species dro05212   Pancreatic cancer dro05215   Prostate cancer dro05220   Chronic myeloid leukemia dro05221   Acute myeloid leukemia dro05222   Small cell lung cancer dro05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dro05321   Inflammatory bowel disease dro05415   Diabetic cardiomyopathy dro05417   Lipid and atherosclerosis dro05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112317202 (RELA)    04014 Ras signaling pathway     112317202 (RELA)    04064 NF-kappa B signaling pathway     112317202 (RELA)    04668 TNF signaling pathway     112317202 (RELA)    04066 HIF-1 signaling pathway     112317202 (RELA)    04071 Sphingolipid signaling pathway     112317202 (RELA)    04024 cAMP signaling pathway     112317202 (RELA)    04151 PI3K-Akt signaling pathway     112317202 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     112317202 (RELA)   09143 Cell growth and death    04210 Apoptosis     112317202 (RELA)    04218 Cellular senescence     112317202 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112317202 (RELA)    04620 Toll-like receptor signaling pathway     112317202 (RELA)    04621 NOD-like receptor signaling pathway     112317202 (RELA)    04622 RIG-I-like receptor signaling pathway     112317202 (RELA)    04623 Cytosolic DNA-sensing pathway     112317202 (RELA)    04625 C-type lectin receptor signaling pathway     112317202 (RELA)    04660 T cell receptor signaling pathway     112317202 (RELA)    04658 Th1 and Th2 cell differentiation     112317202 (RELA)    04659 Th17 cell differentiation     112317202 (RELA)    04657 IL-17 signaling pathway     112317202 (RELA)    04662 B cell receptor signaling pathway     112317202 (RELA)    04062 Chemokine signaling pathway     112317202 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     112317202 (RELA)    04917 Prolactin signaling pathway     112317202 (RELA)    04926 Relaxin signaling pathway     112317202 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     112317202 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     112317202 (RELA)   09149 Aging    04211 Longevity regulating pathway     112317202 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112317202 (RELA)    05202 Transcriptional misregulation in cancer     112317202 (RELA)    05207 Chemical carcinogenesis - receptor activation     112317202 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     112317202 (RELA)    05203 Viral carcinogenesis     112317202 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112317202 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     112317202 (RELA)    05221 Acute myeloid leukemia     112317202 (RELA)    05220 Chronic myeloid leukemia     112317202 (RELA)    05215 Prostate cancer     112317202 (RELA)    05222 Small cell lung cancer     112317202 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112317202 (RELA)    05170 Human immunodeficiency virus 1 infection     112317202 (RELA)    05161 Hepatitis B     112317202 (RELA)    05160 Hepatitis C     112317202 (RELA)    05171 Coronavirus disease - COVID-19     112317202 (RELA)    05164 Influenza A     112317202 (RELA)    05162 Measles     112317202 (RELA)    05168 Herpes simplex virus 1 infection     112317202 (RELA)    05163 Human cytomegalovirus infection     112317202 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     112317202 (RELA)    05169 Epstein-Barr virus infection     112317202 (RELA)    05165 Human papillomavirus infection     112317202 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     112317202 (RELA)    05135 Yersinia infection     112317202 (RELA)    05133 Pertussis     112317202 (RELA)    05134 Legionellosis     112317202 (RELA)    05152 Tuberculosis     112317202 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     112317202 (RELA)    05145 Toxoplasmosis     112317202 (RELA)    05140 Leishmaniasis     112317202 (RELA)    05142 Chagas disease     112317202 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     112317202 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     112317202 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     112317202 (RELA)   09165 Substance dependence    05030 Cocaine addiction     112317202 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112317202 (RELA)    05418 Fluid shear stress and atherosclerosis     112317202 (RELA)    05415 Diabetic cardiomyopathy     112317202 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112317202 (RELA)    04932 Non-alcoholic fatty liver disease     112317202 (RELA)    04931 Insulin resistance     112317202 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     112317202 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     112317202 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:dro03000]     112317202 (RELA) Transcription factors [BR:dro03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     112317202 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  112317202 NCBI-ProteinID:  XP_024430030 LinkDB All DBs Position Unknown AA seq 551 aa AA seqDB search PLSDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHP TIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEAELCPDRCIHSFQNLGIQ CVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVL SHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSF SQADVHRQVAIVFRTPPYADSSLQAPVRVSMHLRRPSDRELSEPMEFQYLPDTDDRHRIE EKRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSIPKPAPQPYPFTPSLSTIN FEEFSPMVFSGQIPSQTSALAPAPAPILAQAPAPAPSMASTLVQASAPVPVLASGLAQAM APPVPKPTQAGEGTLTEALLQLQFDADEDLGSLLGNSTDPAVFTDLASVDNSEFQQLLNQ GVPMAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPIPLGASGLPNGLLSGDEDFTSIADM DLSALLSQISS NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt cctctttcagacctgtttcccctcatcttcccctccgagccagcccaggcctccggcccg tacgtggagatcatcgagcagcccaaacagcggggcatgcgcttccgctacaagtgcgag ggccgctcagcgggcagcattccaggcgagaggagcacagataccaccaagacccaccct accattaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaag gacccccctcaccggcctcacccccacgagctcgtagggaaagactgccgggatggctac tacgaggctgagctctgcccggaccgctgcatccacagcttccagaacctggggatccag tgtgtgaagaagcgggacctggagcaggccattagtcagcgcatacagaccaacaacaac cccttccaagtccccatagaggagcaacgcggagactacgacttgaatgcggtgcggctc tgcttccaggtgacagtgcgggacccgtcaggcaggcccctccgcctgtcacctgtcctc tctcatcccatctttgacaaccgcgcccccaacaccgcagagctcaagatctgccgggtg aaccgaaactctgggagctgccttggtggggatgagatcttcctgctgtgtgacaaagta cagaaagaggacattgaagtgtatttcactggaccaggctgggaggcccgaggctccttt tcgcaagccgatgtgcaccgacaagtggccatcgtgttccggacacctccctacgctgac tccagcctgcaggcccccgtgcgcgtctctatgcacctgcggcggccttcagatcgggag ctcagcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgag gagaaacgcaaaaggacctatgagacctttaagagcatcatgaagaagagtcctttcaat ggacccactgacccccgacctcctccccggcgcattgctgtgccttcccgcagctcgacg tccatccccaagccagctccccagccctatccctttacgccgtccctcagcactatcaac tttgaggagttttcccccatggtcttctccgggcagatcccaagccagacctctgccttg gcaccagcccctgcccccatcctggctcaggccccagcccctgctccatccatggcatca accctggttcaggcctcagcccctgtcccagtcctagcctccggccttgctcaggctatg gccccacctgtccccaagcccacccaggcaggggaagggacactgacagaggcactgcta cagctgcagtttgatgctgatgaagacctggggtccctgctgggcaatagcacagaccca gccgtgttcacggacctggcatccgttgacaactccgagtttcagcagctgctgaaccag ggtgtacctatggccccccacacagcagagcctatgttgatggagtaccctgaggccata acacgcctggtgacagggtcccagcggccccctgacccagctcccattcccctgggggcc tctgggctccccaacggcctcctctcaggggatgaagacttcacctccatcgcagacatg gacttgtcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system