KEGG   Dactylococcopsis salina: Dacsa_1744Help
Entry
Dacsa_1744        CDS       T02378                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dsl  Dactylococcopsis salina
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsl00001]
   00620 Pyruvate metabolism
    Dacsa_1744
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Dacsa_1744
   00680 Methane metabolism
    Dacsa_1744
Enzymes [BR:dsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Dacsa_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1768780..1771803)
Genome map
AA seq 1007 aa AA seqDB search
MSSLLQASSEDTNDASRDQFLDRRIKLIEKLWESVLRAECGQELVNLLQQLRSMGSPEGQ
ATGLPTSSVPQLIEELPLNDAVRAARAFALYFQLINIVEQHYEQREQQLNRLGDEEKNNK
QFSHQKEAEPQHSLLGAELLEKTWQGNSTYQKAGTFNWLFPYLKRLNVPPQQVQRLLNQL
EVRLVFTAHPTEIVRQTIRKKQRRIAKILEQIDYNEATTKSLNFFESPEAVESTEQLEEE
IRLWWRTDELHQFKPEVLDEVDYALHYFQEVLFDTMPQLAKRLKKALKGSFKELTPPRNH
FCRFGSWVGADRDGNPSVTPEVTWETACYQRGIVLERYLHSVKQLTTLLSLSLHWSDVLP
ELLESLEDDRAVMPEVYERLAIRYRREPYRLKLAYIEKRLEHTIQRNQSLYSGEQSQQEA
IKKHPKTIYKSDADFLAELKLIQRNLIETGLACQDLEDLIAQVEIYGFNLAELDMRQESS
RHSETLDEITEYLQILPQSYHQLSESERVKWLSEELQTRRPLIPGELPFSEKTQETVETF
RLLKKLQQEFGTQVCRTYIISMSHEVSDILEVLLLAKEAGIYDPATGSCSLQVVPLFETV
DDLLSAPEIMKALFELPLYRACLAGGYGLEKASNQYDIQEVMLGYSDSNKDSGFLSSNWE
IHKAQKALQSLAEGYGVSLRIFHGRGGSVGRGGGPTYEAILAQPSSTINGRIKITEQGEV
VASKYSLPDLALYHLETATTAVIQGSLLGSGFDDIGPWNSIMEELADRSRQHYRSLIYEE
PDFLDFFLSVTPIQEISQLQISSRPARRQGGKKDLSSLRAIPWVFSWTQTRFLLPAWYGV
GTALKGFLDEETERNREHNLKLLRYFYWKWPFFRMVVSKVEMTLAKVDLQIAHHYLKELA
NSEDYDRFERIFKQIADEYYLASELIRLITDHEKLLDGDPDLQRSVQLRNRTIVPLGFLQ
VSLLKRLREYSNQSASGVIHFRYSKEELLQGALLTLNGIAAGMRNTG
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgagttctctgttgcaagcatccagcgaagatactaacgacgcatctcgtgaccaattc
ctcgatcgacgaattaaactgatagaaaagttatgggaatccgtattaagagcagaatgt
ggtcaggaattagtaaatttactgcaacagttgcgctctatgggatcaccagaaggacaa
gccacaggattacccacatcatccgtaccgcaactaattgaggaacttcccctcaacgat
gcagtaagagccgctcgcgcctttgctttatactttcaattaattaatatcgttgaacaa
cactatgaacaacgggaacaacaattgaaccgtcttggagatgaggaaaaaaacaacaaa
caattttcccatcaaaaggaagccgaacctcaacacagtctcctcggtgcagaactttta
gaaaaaacttggcaaggaaattccacctatcaaaaagctggtacatttaactggttattt
ccctacttaaaacggctcaacgttcctccccaacaagtccaacgcttactcaaccagtta
gaagttcgtctcgtctttaccgcgcaccccacagaaattgttcggcaaacgattcggaaa
aaacagcgtcgcattgccaaaattttagagcaaattgattacaatgaagcaaccactaaa
agtttaaactttttcgagtctccagaagcagtggaatcaacggaacaactagaagaggag
attcggttgtggtggcgcactgatgaattgcatcagtttaaacctgaagttttagacgaa
gtagattatgcactacattactttcaagaagtgttattcgacacgatgcctcagttggcg
aaacgactaaaaaaggcactgaaagggtcttttaaggaattaactcccccaagaaatcat
ttctgtcgctttggatcatgggtaggggccgatcgagatggcaatccctcagtaactccc
gaagtaacttgggaaaccgcctgttatcagcgaggaattgtcttagaaagatatctccat
tcagtgaagcaactgaccactttattaagtttatctttacattggagtgatgttctgcct
gaactattagaatccttagaagacgatcgcgcggtaatgccagaagtttacgaacggtta
gcaattcgctatcgccgagaaccttatcgcttaaaacttgcctacattgaaaagcgttta
gaacataccatacagcgcaaccaaagtttatattcaggagagcaatcgcaacaggaagct
attaaaaaacatccgaaaacgatttataaatcagacgcagattttctagcagaattaaaa
ctgattcagcgtaatctaattgaaacaggattagcttgtcaagacttagaagatttaatt
gctcaagtcgaaatttatggttttaacttagctgagttagatatgcgtcaagagtcgtct
cgtcattccgagacattagacgagattacagaatacttacaaattttaccgcaatcttat
catcaactctcggaatcagaacgagtcaaatggctcagtgaagaactacaaactcgtcgc
cctctcattcctggagaacttcctttttccgaaaaaacccaagaaaccgtagaaaccttc
cgtcttttaaagaagctacaacaagaatttgggacacaagtttgtcgcacttatattatt
agtatgagccatgaagtgagtgacattttagaagtccttctcttggcaaaagaagcagga
atttatgatccagcaacgggaagctgtagcttacaagttgttcccttatttgaaacagtg
gatgatttattaagcgctcccgaaataatgaaagcgttgtttgaattacctttatatcga
gcttgtttagcaggaggatatggtctggaaaaagcaagcaatcagtatgatatacaagag
gtaatgctcggttattctgatagtaataaagattcgggatttttaagcagcaattgggaa
attcataaggcgcaaaaagcactccagagtttagcggaaggttatggggtttctttacgc
atttttcacggacgagggggatcagtgggacgcggtggcggccccacttatgaggcaatt
ttggcacagccgagttctacaatcaacggacggattaaaattacagaacagggagaagtg
gtcgcctctaaatactctctccccgatcttgccttgtatcatttggaaaccgcaacaacc
gcggtgattcaggggagtttactgggaagtggatttgatgatatcggaccctggaatagt
attatggaggaattggcggatcgatcgcgccaacattatcgttccttgatttacgaagaa
ccagactttttagatttcttcctttctgttactcccatccaagaaatcagccaattacaa
attagttctcgtcccgctcgtcgtcaagggggaaagaaagatttaagctctttacgagcg
attccctgggtgttcagttggacacaaacccgttttttacttcccgcttggtacggtgtc
ggaacagcattaaaaggctttttagatgaagaaaccgaacggaatcgcgaacataactta
aaattgttgcgttatttctattggaaatggccctttttccgtatggtggtttctaaggta
gagatgactttagcaaaagttgatctgcaaattgcccatcattatctcaaagaattagct
aactccgaagattacgatcgatttgagcgtatctttaaacaaattgcagatgaatattac
ctcgcaagcgaattaatccgtttaatcaccgaccatgagaaactcctagatggtgatcca
gatttacagcgctcagtacagctacgaaaccgaacgatcgttcctcttggttttttacaa
gtctctcttctcaagcgtctccgtgaatacagtaatcaaagcgcgtcgggagtgattcat
ttccgatacagtaaagaagagttattacagggagcattattaaccctaaatggcattgct
gcgggaatgcgaaacacgggttag

DBGET integrated database retrieval system