KEGG   Dichomitus squalens: DICSQDRAFT_169668Help
Entry
DICSQDRAFT_169668 CDS       T03133                                 

Definition
(RefSeq) glutathione S-transferase C-terminal-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
dsq  Dichomitus squalens
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dsq00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DICSQDRAFT_169668
Enzymes [BR:dsq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DICSQDRAFT_169668
Transporters [BR:dsq02000]
 Other Transporters
  Pores ion channels [TC:1]
   DICSQDRAFT_169668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MSHGKQFTLYTHTGGPNGWKVVNVLEELGLTYEPIYLDFGKNEQKAPEYTKYNPNGRIPT
LIDHKNGDFVLWESDAILLYLTDKYDTEKRLTVTDEKEKYSLFKWLFFQSSGQGPYFGQA
AWFLRYHPEQVPSAIERYRKETLRVMSVLESVLSKQEWLVGGKPTIADFSFITWNNVALS
FTLKDYADVQKEYPAFHAWHQKLVSRDSVKKALATQAALSQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacggcaagcagttcacgctctacacccacaccggcggtcccaacggctggaaa
gttgtgaatgttctcgaggagctcggattgacctacgagcccatctacctcgacttcgga
aagaacgagcagaaggctccggagtacaccaagtataacccgaacggccgtatccccacc
ctcatcgaccacaagaacggcgacttcgtgctctgggagtccgacgccatcctcctctac
ctcaccgacaagtacgacacagagaagcggctgaccgtcaccgacgagaaggagaaatac
tccctcttcaagtggctcttcttccagtcctcgggccagggcccgtacttcggccaggcg
gcgtggttcctgcgctaccaccccgagcaggttcccagcgcgatcgagcggtaccgcaag
gagaccctgcgcgtgatgtccgtccttgagtcagtgttgtcgaagcaggaatggctcgtg
ggaggcaagccgacgattgcggacttctctttcatcacctggaacaacgtcgcgctcagc
ttcactcttaaggactatgccgacgtccaaaaggagtacccggcgttccacgcgtggcac
cagaagctggtgtctcgcgacagtgtcaagaaggcccttgccacacaagctgccttgagc
caatga

DBGET integrated database retrieval system