KEGG   Dechlorosoma suillum: Dsui_1603Help
Entry
Dsui_1603         CDS       T01657                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dsu  Dechlorosoma suillum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dsui_1603
  Energy metabolism
   00680 Methane metabolism
    Dsui_1603
Enzymes [BR:dsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Dsui_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1684012..1686819
Genome map
AA seq 935 aa AA seqDB search
MSLHAPAPSADLSAAADKDQPLREDIRLLGRLLGDTVREQEGGEAFTAVETIRQIAVRFA
RDQEPAARDELAAILNGLPRDTMLSVVRAFTYFLHFANIAEDQHHIRRRRTHEIAGSEAR
EGSLAYALERLAEAGVGGEALAEALGHSLVSPVLTAHPTEVSRKSILHCQREVARLLDTR
DRVAMTPEEAADNDAALRAAVLTLWRTRMLRPNRLAVVDEVKNGISYYDDTFFAELPRLY
CQFEDQLKSRFPEQSWDLPNFFRIGSWIGGDRDGNPFVTADILKEALRLQSSAALDFYLD
EIHALGADLPLSQMLLPVSAELAALADRSPDRSPHRADEAYRRALTGIYARLAATSESLD
RHPPLRHAVAESAPYDSSAALVADLQVLAASLAAHGAGLLARGRLRRLIRAVQVFGFHLA
PIDLRQNSDVHERSVAELLALAGRLPSVEAYSALDEAARIALLAEEIASPRPLYSPYLAY
SEETAGELAIFFAARELKARYGDAALPNCIISKTDGASDLLEVALLAKEAGLLIPGAAPK
LAVNIIPLFETIDDLRRSAPVMASLFALPAYRALVAARGEEQEVMLGYSDSNKDGGFLTS
GWELYKAEIDLTRVFAAAGVRLRLFHGRGGSVGRGGGPSYQAILAQPAGAVSGQIRITEQ
GEVIASKYANPEVGRRNLEILAAATLEATLTDHENRVEPARPYHAVLDRLSQLAFSAYRG
LVYETPGFTTYFRESTPVSEIANLNIGSRPASRKKSEAIEDLRAIPWVFSWAQCRLMLPG
WYGFGSAVEAWLGEHPEGREAGLATLRKMYRNWPFFRTLLSNMDMVLAKSDIAIASRYAE
LVTDAELRAAIFGRIKAEWERTRELLLAIEEQAELLADNPLLKRSIRNRFPYMDPLNHLQ
VELLHRHRAGETDERIRRGIHLTINGVAAGLRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgcacgctcccgccccttctgccgacctctctgccgccgccgacaaggaccag
cccctgcgggaggacatccgcctcctgggccgcctcctcggcgacaccgtgcgcgaacag
gagggcggcgaggccttcaccgccgtcgagaccatccgccagatcgccgtgcgcttcgcc
cgggaccaggagccggcggcccgggacgagctggccgccatcctcaacggcctgccccgg
gacaccatgctctccgtggtgcgggccttcacctatttcctgcacttcgccaacatcgcc
gaggatcagcaccacatccgccgccgccgcacccatgaaatcgccggctccgaggcgcgg
gaaggcagtctggcctacgccctggagcgcctggccgaagccggcgtcggcggcgaggcc
ctggccgaggctctgggtcattccctggtctccccggtgctgacggcccaccccaccgaa
gtcagccgcaagagcatcctgcactgccagcgggaggtggcccgcctgctggatacccgg
gaccgggtggccatgaccccggaagaggcggccgacaacgacgccgccctgcgcgccgcc
gtgctcaccctgtggcgcacccgcatgctgcggcccaaccggctggcggtggtggacgag
gtgaagaacggcatcagctactacgacgacaccttcttcgccgaactgccccggctctac
tgccaattcgaagaccagctgaaatcccgcttcccggagcagtcctgggacctgcccaac
ttcttccgcatcggcagctggatcgggggcgaccgggacggcaaccccttcgtcaccgcc
gacatcctcaaggaagccctgcgcctgcagtcgtccgccgccctggatttctatctcgac
gaaatccacgccctcggcgccgacctgcccctgtcccagatgctgctgcccgtgtcggcg
gaactggcggccctggccgaccgctccccggaccgttccccccaccgggcggacgaagcc
taccggcgcgccctcaccggcatctacgcccgcctggccgccacctccgaatccctggac
cggcacccgccgctgcgccacgccgtggccgagagcgcgccctatgactcgtccgccgcc
ctggtagccgatctccaggtgctggccgcctccctcgccgcccatggcgccggcctgctg
gcccggggccgcctgcgccgcctgatccgggcggtgcaggtattcggcttccacctggcc
cccatcgacctgcgccagaactcggacgtgcacgaacgcagcgtcgccgaactgctggcc
ttggccggccgcctgccttccgtcgaagcctattccgccctcgacgaagccgcccgcatc
gccctgctggcggaggaaatcgccagcccccggcccctctactcgccctacctggcgtac
tcggaagaaacggccggcgaactggccatcttcttcgccgcccgggaactgaaggcccgc
tacggcgacgccgccctgcccaactgcatcatctccaagaccgacggcgcctccgatctg
ctggaagtggccctgctggccaaggaggccgggctgctgattccgggtgccgcaccgaag
ctggcggtaaacatcattcccctgttcgagaccatcgacgacctgcgccgctccgccccg
gtcatggccagtctctttgccctgccggcctaccgggccctggtggccgcccggggcgag
gagcaggaggtgatgctgggctattcggacagcaacaaggacggcggcttcctcacttcc
ggctgggagctgtacaaggccgagatcgacctgacccgggtttttgccgcagcaggcgtg
cgcctgcgcctcttccacggccgcggcggttccgtcggccggggcggcggccccagctat
caggccatcctggcccagcccgccggcgccgtctccggccagatccgcatcaccgagcag
ggcgaggtcatcgcctccaagtacgccaacccggaagtgggccggcgcaacctggagatt
ctcgccgccgccaccctggaagccaccctcaccgaccacgaaaaccgggtggagccggcc
aggccctaccacgccgtgctcgaccgcctttcgcagctggccttttccgcctaccggggc
ctggtgtacgagaccccgggcttcaccacctatttccgcgaatcgacgccggtttccgag
atcgccaacctcaacatcggcagccgcccggcctcgcgcaagaagtcggaggccatcgag
gacctgcgggccattccctgggtcttcagttgggcccagtgccgcctcatgctgcccggc
tggtacggcttcggcagcgccgttgaggcctggctgggcgagcacccggaagggcgggag
gcgggtctggccaccctgcgcaagatgtaccgcaactggcccttcttccgcaccctgctc
tccaacatggacatggtgctggccaagagcgacatcgccatcgcttcccgctacgccgaa
ctggtgactgatgccgagctgcgcgccgccatcttcggccgcatcaaggccgagtgggag
cgcacccgggaactgctgctggccatcgaggaacaggccgaactgctggcggacaacccg
ctcctgaagcgctccatccgcaaccgcttcccctacatggacccgctgaatcacctgcag
gtggaactgctgcaccgccaccgggccggggagacggacgagcgcatccgccgcggcatc
cacctcaccatcaacggggtggccgccggtctgcgcaacagcggctga

DBGET integrated database retrieval system