KEGG   Delftia tsuruhatensis: BI380_23445Help
Entry
BI380_23445       CDS       T04496                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
dts  Delftia tsuruhatensis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dts00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BI380_23445
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BI380_23445
Enzymes [BR:dts01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BI380_23445
Peptidoglycan biosynthesis and degradation proteins [BR:dts01011]
 Precursor biosynthesis
  Racemase
   BI380_23445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5091990..5093093
Genome map
AA seq 367 aa AA seqDB search
MPRPILATIHSAALRHNLERVRQAVPDAKLWAVVKANAYGHGIENVFEALRGADGFAMLD
LAEAERVRQLGWRGPILLLEGVFEPRDLELCSRLSIWHAVHCDAQIDWLAAHKTQNGHRV
FLKMNSGMNRLGFTPERFRAAWARLNALPQVEEISFMTHFSDADAGAGQSGISAQLQRFH
DATCDLPGERSVGNSAATLRHGDDAQVRCDWVRPGIVLYGSSPDYPQHTAAHWGLQPTQT
LSSRIIGVQQLAAGQSVGYGSRFTAEAPVRLGTVACGYADGYPRHCGTGTPVLVDGVRTR
TLGRVSMDMLAVDLTPVPDACMGSEVTLWGRASNGAVLPIDEVAEAAGTLGYELMCAVAP
RVNKTVD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtcccattcttgccaccatccattccgccgcgcttcgccacaatctggagcgg
gtgcggcaagcggtccccgatgccaaattgtgggccgtggtcaaagccaacgcctatggc
cacggtatcgaaaacgtgttcgaggccctgcgcggcgccgacggcttcgccatgctggac
ctggccgaggccgagcgcgtgcgccagctgggctggcgcggccccatcctgctgctggag
ggcgtgttcgagccgcgcgacctggagctttgctcgcgcctgtccatctggcatgccgtg
cattgcgacgcccagatcgactggctggccgcgcacaagacgcagaacggccaccgcgtc
ttcctcaagatgaactccggcatgaaccgcctgggcttcacgcccgagcgctttcgcgcg
gcctgggcccggctcaatgccttgccccaggtggaggaaatctcgttcatgacccacttc
agcgatgccgacgcaggcgctggccagtcgggcatctccgcgcagctgcagcgctttcac
gacgccacgtgcgacctgcccggcgagcgcagcgtgggcaacagtgccgccacgctgcgc
catggcgacgatgcccaggtgcgctgcgactgggtgcggcccggcatcgtgctgtacggc
agctcgcccgactatccgcagcacacggcggcccattggggcctgcagcccacgcagacc
ctgagctcgcgcatcatcggcgtgcagcagctggctgcggggcagagcgtgggctatgga
tcgcgcttcacggccgaagctcccgtgcgcctgggcaccgtggcctgcggctatgccgac
ggctatccgcgccactgcggcaccggcacgcccgtgctggtcgacggcgtgcgcacccgc
accctgggccgcgtgagcatggacatgctggccgtggacctgacgcccgtgcccgatgcc
tgcatgggcagcgaagtcacgctgtggggccgcgccagcaacggcgccgtgctgcccatc
gacgaggtggccgaggcggccggcacgctgggctatgaactcatgtgcgccgtcgcgccg
cgcgtgaacaagaccgtcgattga

DBGET integrated database retrieval system