Drosophila willistoni: 6639601 Help Entry 6639601           CDS       T01067                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dwi  Drosophila willistoni Pathway dwi04013   MAPK signaling pathway - fly dwi04145   Phagosome dwi04148   Efferocytosis dwi04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dwi00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6639601    04310 Wnt signaling pathway     6639601  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6639601    04148 Efferocytosis     6639601  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dwi04131]     6639601   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dwi04147]     6639601    04031 GTP-binding proteins [BR:dwi04031]     6639601 Membrane trafficking [BR:dwi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6639601  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6639601   Macropinocytosis    Ras GTPases     6639601  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6639601 Exosome [BR:dwi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6639601   Exosomal proteins of other body fluids (saliva and urine)    6639601   Exosomal proteins of colorectal cancer cells    6639601   Exosomal proteins of bladder cancer cells    6639601 GTP-binding proteins [BR:dwi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6639601 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  6639601 NCBI-ProteinID:  XP_002062151 FlyBase:  FBgn0218805 UniProt:  B4ML79 LinkDB All DBs Position XR Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPNVPIILVGTKLDLR DDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPV MRGNVSKKCSLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcaatcaagtgtgttgtagttggcgatggcgccgtgggtaagacctgccttttg atcagctatacaacaaatgcctttccgggcgaatatatacccacggtatttgacaactat tcggccaatgtgatggtcgatgccaaacccatcaatttgggtctatgggatactgccgga caagaggattatgatcgtttgcgtccactatcgtatcctcagacggacgtctttctcatt tgcttttcgctggtgaatccggcctcatttgagaatgtgcgtgccaaatggtttccggag gtgcgtcatcattgccccaatgtgcccatcattctggttggcaccaaactggatttgcgt gacgataagcagaccatcgagaagctaaaggataagaaattaacaccaatcacatatcca cagggtctggccatggccaaggagatagcagctgtcaagtatctggagtgttcggcattg acccaaaagggtctcaaaacggtattcgatgaggcaatccgttctgtactctgtcccgtt atgcgcggcaatgtgtctaagaaatgttcactgctgtag

DBGET integrated database retrieval system