Drosophila willistoni: 6650000 Help Entry 6650000           CDS       T01067                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism dwi  Drosophila willistoni Pathway dwi04013   MAPK signaling pathway - fly dwi04068   FoxO signaling pathway dwi04137   Mitophagy - animal dwi04140   Autophagy - animal dwi04150   mTOR signaling pathway dwi04213   Longevity regulating pathway - multiple species dwi04214   Apoptosis - fly dwi04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:dwi00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6650000    04068 FoxO signaling pathway     6650000    04150 mTOR signaling pathway     6650000  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6650000    04137 Mitophagy - animal     6650000   09143 Cell growth and death    04214 Apoptosis - fly     6650000  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     6650000   09149 Aging    04213 Longevity regulating pathway - multiple species     6650000  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dwi04131]     6650000   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dwi04031]     6650000 Membrane trafficking [BR:dwi04131]  Endocytosis   Macropinocytosis    Ras GTPases     6650000 GTP-binding proteins [BR:dwi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     6650000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Motif Other DBs NCBI-GeneID:  6650000 NCBI-ProteinID:  XP_002072879 FlyBase:  FBgn0215846 UniProt:  B4NJ72 LinkDB All DBs Position 3R:4718673..4720689 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL PSWNVQNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRKGRKLNKP NRRFKCKML NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaaactagttgttgttggtgccggtggcgttggcaaatcggcattaaca attcagttaattcaaaatcattttgttgatgaatatgatcccacaattgaggactcgtat cgaaagcaagtggttattgatggtgaaacctgccttctggacattttggataccgccgga caagaagaatactctgccatgcgtgatcaatatatgcgcactggcgagggattcctctta gttttcgctgtgaatagtgcaaaatcattcgaagacattggcacatatcgcgaacagatc aaacgtgtcaaagatgccgaagaggtgccaatggtgcttgtgggcaataaatgtgatctg ccctcgtggaatgtgcaaaacgaacaggcaagagaggtggccaaacaatatggcattcca tacattgagacatccgccaagacgcgcatgggcgttgatgatgcattttacacattggtg cgcgaaatacgcaaggataaggacaacaaaggacggaagggacgtaaactcaataagccg aatcgtagatttaaatgcaaaatgctctaa

DBGET integrated database retrieval system