KEGG   Dickeya chrysanthemi: Dd1591_0228Help
Entry
Dd1591_0228       CDS       T00930                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00564  Glycerophospholipid metabolism
dze01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dd1591_0228
Enzymes [BR:dze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dd1591_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N Lycopene_cycl GIDA FAD_oxidored HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACT05121
JGI: Dd1591_0228
UniProt: C6CGQ2
LinkDB All DBs
Position
complement(277248..278747)
Genome map
AA seq 499 aa AA seqDB search
METKDLIVIGGGINGTGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVGEALSEREVLLKMAPHIIFPMRFRLPHQPHLRPAWMIRAGLFMYDHLGKRVSLPSS
HGLRFGRESVLKPELTRGFEYSDCWVDDARLVVLNAQEVVRRGGDVKTRMKVTRAHRENG
LWIVEAEDTLSGEIHRWQAKGLVNATGPWVRQFFDDGLALPSPYGIRLIKGSHIVVPRVH
QEEQAYILQNKDHRIVFVIPWQDDFSIIGTTDVEYHGDPHQVKIDDNEIRYLLDVYNDHF
KKQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVADENGKAPLLSVFGGKLTTYRK
LAEHALEKLVKYYPQAGQAWTRNAILPGGDLSGSREDYAATLRRRYNLPEALARRYSRTY
GSQSEKILGNAQSLNDLGEHFGHTLYEAELRYLVEHEWVVSLEDAIWRRTKLGMWLDDAQ
RQRVADWLVSYRSQLAKAG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgatcgtgatcggcggaggcattaacggtaccggcatcgcagca
gacgccgccgggcgcgggttatccgtcttgctgctggaagcacaggacctggcctgcgcc
acctcttccgccagctcaaagctgattcacggcggcctgcgctatctggaacactatgag
ttccgcctggtgggcgaagcgctgtccgaacgcgaagtgctgctgaaaatggcgccgcac
atcattttcccgatgcgttttcgtctgccgcatcagccgcatctgcgcccggcctggatg
attcgcgccggtctgttcatgtacgaccatctgggaaaacgcgttagcctgccgtccagc
cacgggctgcggtttggccgcgaatccgtgttgaaaccggaactgacgcgcggtttcgaa
tattccgattgctgggtggacgatgcgcgtctggtggtgctaaacgcgcaggaagtggtg
cgccgcggcggcgacgtgaaaacgcgcatgaaagtaacccgcgcccaccgcgaaaacggt
ctgtggatcgttgaagcggaggatacgctgagcggcgaaatccatcgctggcaagcgaaa
gggctggtcaatgcgaccgggccgtgggtacgccaattcttcgacgatggtctggcgctg
ccatcgccgtacggcatccgtctgattaagggcagccatatcgtcgttccgcgtgtgcat
caggaagagcaggcctacattctgcaaaacaaagatcaccgcatcgtgttcgtgatcccg
tggcaggacgatttttcgatcatcggcaccaccgatgtggagtaccacggcgatccgcat
caggtgaagatcgacgacaacgaaatccgttacctgctggatgtgtataacgaccatttc
aaaaaacagctgacgcgcgacgacattgtctggacttactccggcgtgcgcccgctgtgc
gacgacgagtcggattcaccgcaggccatcacccgcgactacacgctgtccgttgcggac
gaaaacggcaaagcgccgttgctgtcggtattcggcggcaaattaaccacctaccgtaag
ttagcggaacacgcgctggaaaagctggtgaaatactacccgcaagccggacaagcatgg
acccgcaacgcgattctgcccggtggcgacctcagcggcagccgtgaagattatgccgcc
acattgcgccgccgttacaatctgccggaagcgctggcacgccgttacagccgtacctac
ggtagccagagcgagaaaatcctcggcaacgcgcaaagcttgaacgatttgggcgaacac
ttcggccataccttatacgaagccgagttacgctatctggtagagcatgaatgggtggtg
tcgctggaagacgctatctggcgccgcaccaagctcggcatgtggctggacgacgcgcaa
cgccagcgtgtcgccgactggctggtcagctaccgcagccagttagccaaagccggttaa

DBGET integrated database retrieval system