KEGG   Dickeya zeae Ech1591: Dd1591_0319Help
Entry
Dd1591_0319       CDS       T00930                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
dze  Dickeya zeae Ech1591
Brite
Translation factors [BR:dze03012]
 Eukaryotic Type
  Elongation factors
   Dd1591_0319
 Prokaryotic Type
   Dd1591_0319
Mitochondrial biogenesis [BR:dze03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dd1591_0319
Exosome [BR:dze04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dd1591_0319
  Exosomal proteins of breast cancer cells
   Dd1591_0319
  Exosomal proteins of colorectal cancer cells
   Dd1591_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
373480..374664
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGQARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccatcactaccgttctggcaaaaacctac
ggtggccaggctcgtgcattcgaccagatcgacaacgcgccggaagaaaaagcacgtggt
atcaccatcaacacctctcacgttgaatacgataccccgacccgtcactacgcgcacgtt
gactgcccagggcacgccgactacgtaaaaaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgttcatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccgggcgacgacacgccggttatccgcggttccgcgctgaaagcgctggaa
ggcgaagccgagtgggaagcgaaaatcatcgaactggccgaagcactggacagctacatt
ccggaaccggagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctct
atctccggccgtggtacagttgtgactggtcgtgtagagcgcggtatcgtgaaagtgggt
gaagaagtggaaatcgtgggtatcaaagacaccgcgaaaaccacctgtaccggcgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggcgagaacgttggcgttctgctgcgt
ggtaccaagcgtgatgaagtagagcgtggtcaggtactggctaaaccgggctcaatcaag
ccgcacactcagttcgaatctgaagtgtacatcctgagcaaagacgaaggtggccgtcat
acgccgttcttcaaaggctaccgtccgcagttctacttccgtaccactgacgtgaccggt
accatcgaactgccggaaggcgtggaaatggttatgcctggcgacaacatcaagatggtc
gtaaacctgatcgcgccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgccggcgtggttgccaaagttatcgcttaa

DBGET integrated database retrieval system