KEGG   Escherichia coli ABU 83972: ECABU_c18880Help
Entry
ECABU_c18880      CDS       T01995                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECABU_c18880 (gst)
Enzymes [BR:eab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ECABU_c18880 (gst)
Transporters [BR:eab02000]
 Other Transporters
  Pores ion channels [TC:1]
   ECABU_c18880 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_2 GST_N GST_N_3 Glutaredoxin2_C GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ADN46433
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1873524..1874129
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLVSVDLMKKRLENGDDYFAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDTPEE
YKSTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFTVLRWAYAVKLNLEGLEHIAA
FMQRMAERPEVQDALSAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctacaaaccgggcgcctgctctctcgcttcccatatcaccctgcgtgag
agcggaaaggattttacgctcgtcagtgtggatttaatgaaaaaacgtctcgaaaacggt
gacgattactttgccgttaaccctaagggacaggtacctgcattgctgctggacgatggt
actttgctgacggaaggcgtagcgattatgcagtatcttgccgacagcgtccccgaccgc
cagttgctggcaccggtaaacagtatttcccgctataaaaccatcgaatggctgaattac
atcgccaccgagctgcataaaggtttcacacctctgtttcgccctgatacaccggaagag
tacaaatcgacagttcgcgcgcagctggagaagaagctgcaatatgtgaacgaggcactg
aaggatgagcactggatctgcgggcaacgatttacaattgctgatgcctatctgtttacg
gttctgcgctgggcatacgcggtgaaactgaatctggaagggttagagcacattgcggca
tttatgcaacgtatggctgaacgtccggaagtacaagacgcgctgtcagcggaaggctta
aagtaa

DBGET integrated database retrieval system