KEGG   Escherichia coli ABU 83972: ECABU_c29250Help
Entry
ECABU_c29250      CDS       T01995                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase-like aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00250  Alanine, aspartate and glutamate metabolism
eab00280  Valine, leucine and isoleucine degradation
eab00410  beta-Alanine metabolism
eab00640  Propanoate metabolism
eab00650  Butanoate metabolism
eab01100  Metabolic pathways
eab01120  Microbial metabolism in diverse environments
Module
eab_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECABU_c29250 (gabT)
   00650 Butanoate metabolism
    ECABU_c29250 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECABU_c29250 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ECABU_c29250 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECABU_c29250 (gabT)
Enzymes [BR:eab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECABU_c29250 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECABU_c29250 (gabT)
Amino acid related enzymes [BR:eab01007]
 Aminotransferase (transaminase)
  Class III
   ECABU_c29250 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADN47411
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2993613..2994893
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGEHSKPDVKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcggtgaaa
atcgcccgcgccgccaccaaacgtagcgggaccatcgcctttagcggtgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcatgggatcatgctgattgccgatgaa
gtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggacgccgtcgcaccgggcggactgggtggcacctatgccggt
aacccgattgcctgcgtagcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgttctggggcagaagctgaaagacggattgctggcgatcgccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccatcgagctgttt
gaagatggcgaacacagcaaaccggacgtaaaactcaccgccgagatcgtggcacgcgcc
cgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggaaatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system