KEGG   Klebsiella aerogenes KCTC 2190: EAE_07635Help
Entry
EAE_07635         CDS       T01529                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00620  Pyruvate metabolism
eae00680  Methane metabolism
eae01100  Metabolic pathways
eae01120  Microbial metabolism in diverse environments
eae01200  Carbon metabolism
Module
eae_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAE_07635
  Energy metabolism
   00680 Methane metabolism
    EAE_07635
Enzymes [BR:eae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EAE_07635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 10791703
NCBI-ProteinID: YP_004591730
UniProt: A0A0H3FNZ5
LinkDB All DBs
Position
complement(1588785..1591436)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPNLNED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYEHNQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLISELSMVECTDELR
DLAGAEGAQEPYRYLMKKLRSQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKSFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCKVIAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKPQWREIMAEL
SDVSCKMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELESMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWKLGEELRQLLTADIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEAGEEPDARVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgtagtaatgtcagtatgctcggtaaggtgctgggc
gacaccatcaaggatgcgttaggagaaaacattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttctcgcgcgggcaatgaagccaatcgccaggagctgctcaccacgctg
caaaacttgtccaacgacgagctgctgccggtggcgcgcgcctttagccagttcctgaat
ctggccaataccgctgagcaatatcacagcatttcgcccaacggcgaagccgccagcaat
ccggaagttattgcgcgtaccctgagaaaactcaaagaccaacccaatctcaacgaagac
accataaaaaaagcggtggaatccctgtcgctggagctggtattaaccgctcacccgacc
gaaatcacccgccggacgctgatccacaaaatggtggaagtgaacaactgccttaagcag
ttggataacaaagatatcgccgactatgagcacaaccagctgatgcgccgcctgcgccag
ctgatcgcccagtcctggcataccgatgaaattcgtaagcaccgcccttctccggtcgat
gaagccaaatggggtttcgcggtagttgaaaacagcctgtgggaaggcgtgccgaactat
ctgcgcgagctgaacgaacagctggaagccaacctcggctaccagctaccggttgatttt
gtgccggtacgattcacttcctggatgggcggcgaccgtgacggcaacccgaacgtcacc
gccgatatcacccgccacgtactgttgctcagccgctggaaagcgaccgatctgttcctg
aaagatatccaggtgcttatctccgagctgtcgatggtcgaatgcaccgacgagctccgc
gatttggcgggtgcggaaggcgcgcaagagccgtatcgttatctgatgaaaaagctgcgt
agccagttgatggagacccaggcctggctggaagcgcgtctgaaaggacaaaaactgccg
aaaccggcggggcttatcacgcaaaacgaacagctgtgggaaccgctgtatgcctgctat
aaatcgctgcaggcctgcggaatgggcatcatcgccaacggcgaactgctcgataccctg
cgccgggtgaaatctttcggcgtaccgctggtgcgtatcgatatccgtcaggaaagtacc
cgccataccgaagcgctgggcgaaatgacccgctacctcgggatcggcgattatgaaagc
tggtcggaagccgacaagcaggccttcctgatccgtgagctgaactccaaacgcccgctg
ctgccgcgtcagtgggagccgagcgaagagacccgcgaggtcctcgacacctgtaaagtg
atcgccgaagcgccgcgtggatcgatcgccgcttatgtgatctcaatggccaaaacgccg
tccgacgtgctggcggttcatcttctgctaaaagaagccggtatcggctttgccctgccg
gtcgcgccgctgtttgaaacgctggacgacctgaacaacgccaacgacgttatgactcag
ttactgaatattgactggtatcgcggctttattcagggcaagcagatggtcatgatcggt
tactccgactcggccaaagatgccggcgtgatggccgcctcctgggcccagtaccaggca
caggacgcgctaatcaaaacctgcgaaaaagccggtattgaactgactctattccacggt
cgcggtggctccatcggtcgcggcggcgctccggcccacgcggcgctgctctcgcagccg
ccgggcagcctgaaaggcggcctgcgcgtcaccgaacagggcgaaatgatccgctttaag
tacggcctgccggaagtgaccatcagcagcctgtcgttgtacaccagcgcgattctggaa
gccaacctgctgccgccgccggaaccaaaaccgcagtggcgcgaaatcatggccgagctg
tccgacgtctcctgcaagatgtaccgcggctacgtgcgggaaaacaaagacttcgtccct
tatttccgctccgcgaccccggaacaagaactgggcaaactgccgcttggctcgcgcccg
gcgaagcgtcgcccgaccggcggcgtcgagtcactgcgcgccatcccgtggatcttcgcc
tggacccagaaccgcctgatgctgccggcctggctgggcgccggtgccgcgctgcagaaa
gtggtcgagggcggtaagcaaagcgagctggaaagcatgtgccgcgactggccgttcttc
tcgacccgcctcggaatgctggaaatggtctactcaaaagccgacctgtggctggcggag
tactacgatcagcgtctggtgaaaccggaactgtggaagctaggcgaagagctacgtcag
ctgttaaccgccgatatcaaagtggtgctggctatcgctaatgactcccacctgatggcc
gacctgccgtggatcgccgaatccatccagttgcgtaacatctataccgacccgcttaac
gtcctgcaggccgaactgttgcaccgttcgcgccaggctgaagaggctggcgaggaaccg
gatgcgcgcgttgagcaagcgctgatggtcaccattgccggcgtcgcggcagggatgcgt
aataccggctag

DBGET integrated database retrieval system