KEGG   Klebsiella aerogenes KCTC 2190: EAE_17795Help
Entry
EAE_17795         CDS       T01529                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EAE_17795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 10793785
NCBI-ProteinID: YP_004593747
UniProt: A0A0H3FS19
LinkDB All DBs
Position
complement(3845144..3845725)
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTAFEGKSLEEIVRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPEGELAAAINKSFGSFADFKAKFTDAAAKNFG
AGWTWLVKNADGSLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPNYLEHFWA
LVNWKFVAANLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgaattacctgcattaccatatgcaaaagacgccctggcgccgcacatttcc
gcagaaaccctggaataccattacggtaaacatcaccaggcctacgtgaccaacctcaac
aacctgatcaaaggcaccgcttttgaaggcaaatctctggaagagatcgttcgctcttct
gaaggcggcgttttcaataacgcagcgcaggtctggaaccacactttctactggaactgc
ctggcgccgaacgccggcggtgagccggaaggcgaactggccgcagcgattaacaaatct
ttcggtagcttcgctgattttaaagcgaaattcaccgatgccgcggcgaaaaacttcggc
gcaggctggacctggcttgttaaaaacgctgacggcagcctggctatcgtctccaccagc
aacgccggcactccgctgactaccgatgcgacgccgctgttgaccgttgatgtctgggaa
cacgcctactacatcgactaccgcaatgcccgtcctaattatctggaacacttctgggcg
ctggtaaactggaaatttgttgccgccaacctggcagcataa

DBGET integrated database retrieval system