KEGG   Klebsiella aerogenes KCTC 2190: EAE_23060Help
Entry
EAE_23060         CDS       T01529                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EAE_23060
Enzymes [BR:eae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EAE_23060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4900676..4902163
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPEGGELWREVEALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLAAINALKEHQIAVLLDVVVNHKMGADEKERIRVQRV
DEQDRTQIAEEIIECEAWTRYTFPGRGGKYSQFIWDYKCFSGIDHIENPDEDGVFKVVND
YTGDGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVIEQTGCDGFRLDAVKHI
PAWFYKEWIEHVQGATDKPLFIVAEYWSHEVDKLQQYIDLVDGNTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVTNHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYADLFGASYEDTGGDGQTYSIEMPVIEQLHELIDARQRFAHGVQTLWFDHPNCI
AFSRSGTDEHPGCVVVLSNGDDGEKTLPLGENYANKRWKDFLNNRQEVIETDDEGNAVFT
CNAGSVSVWVIEEVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcccacgttgttgcaatgttttcactggtattacccggaaggtggcgagtta
tggcgggaagtagaagcccttgcgccaaatctcaatgaaattggcattaatatgatttgg
ttgccgcccgcctataagggcgcttccggcggttattcagttggctacgatagttacgat
cttttcgacctcggtgaattcgatcagaaaggatcggttgccaccaaatacggcgataaa
gctcagctgttagcggcgattaatgcgctaaaagaacatcaaattgccgtacttcttgat
gtcgtcgtaaaccacaagatgggcgccgatgagaaagaacgcatccgcgtacaacgcgtt
gatgaacaggaccgcacgcaaatcgcggaagaaatcatcgaatgtgaagcctggacccgc
tatacctttccgggccgcggtggcaaatattcacaatttatctgggactataaatgtttt
agcggtatcgaccatatcgaaaatcccgatgaagatggcgtattcaaagttgttaatgac
tacaccggcgatggctggaacgatcaggtcgacgatgaaatgggcaacttcgattatctc
atgggcgaaaatatcgatttccgtaaccatgccgtgaccgaagagataaaatattgggcc
cgctgggtcattgaacagaccggctgcgatggtttccgcctggatgccgtcaaacatatt
ccggcatggttttataaagagtggattgagcatgtgcagggggccaccgataaaccgcta
tttattgttgccgaatactggtcacacgaggtggataagctacagcagtacatcgacctt
gttgacggtaataccatgctgtttgatgcgccgctgcagatgaaattccatgaagcctcg
cgtcagggccgcgattacgacatgagtcaaatcttcaccgggacgctggtggaagccgac
ccattccatgcggtcacgttggtcacaaatcatgacacccaaccgcttcaggcgctggaa
gcgccggtcgaggcctggtttaagccgttagcctatgcgctgattttactgcgtgaaaac
ggtgttccctcggtattttacgccgacctgttcggcgcaagttatgaagataccggcgga
gatggccagacatactccatcgagatgccggttatcgagcagcttcacgaactcatcgat
gcgcgtcagcgtttcgcccacggcgtacaaacgctgtggttcgatcatcctaactgtatc
gccttcagccgcagcggcaccgatgaacatcctggctgcgtagtggtgctctccaacggc
gacgatggcgagaaaacgttaccgcttggcgagaattatgccaataaacgctggaaggat
tttctcaataatcgacaagaggttattgagactgatgacgagggcaatgccgtattcacc
tgtaatgcaggcagcgtaagcgtgtgggtgattgaagaggtgctttga

DBGET integrated database retrieval system