KEGG   Ensifer adhaerens Casida A: FA04_04255Help
Entry
FA04_04255        CDS       T04507                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
eah  Ensifer adhaerens Casida A
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eah00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    FA04_04255
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    FA04_04255
Enzymes [BR:eah01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FA04_04255
Peptidoglycan biosynthesis and degradation proteins [BR:eah01011]
 Precursor biosynthesis
  Racemase
   FA04_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(901242..902381)
Genome map
AA seq 379 aa AA seqDB search
MLPPDFLSASNRLTIDLGALVDNWRAMNKRSGKARAAAVLKADAYGIGIAQAAPALYAAG
ARDFFVANAEEGAALRPLAPDGRIYILAGMWPGNEALFFDNDLVPVINSDEQLAVFMAAL
SERGDHPCVLHVDTGMNRLGLTVEQAVALATDPARPASFSPVLIMSHLVSADDPDHRLNG
LQLRRFHEVSTAYEGVDASLANSGGVFLGPDYHFDLTRPGIAVYGGEAVNDIPNPMKPVV
TAEARIIQVRDVAAGGTASYGASARFDRDSRIATVAVGYADGYHRSVSGGGVTLRQATPS
GAFGFLHGQKVPHVGRVTMDLSLFDVTDLPESAVRPGDYIELFGRHIAIDDVARAGGTIG
YEMLTSLGRRYIRHYIDSV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctccagacttcctttccgcttccaaccggctcacgatcgatcttggcgcgctt
gtcgacaactggcgggccatgaacaagcgctccggcaaggcgcgtgccgcagccgtgctc
aaggcggatgcctatggcatcggcatcgcgcaggcggcccctgccctctatgcggccggc
gcccgcgatttctttgtcgccaatgccgaggaaggcgcagcactccgtccgcttgcaccg
gacggccggatctacattctcgccgggatgtggccgggcaacgaggcgctgttcttcgac
aacgatctggtgccggtcatcaactcggacgagcagctggccgtgttcatggccgccctt
tccgagcgtggcgaccacccttgcgtgctgcatgtggataccggcatgaaccggctcggc
cttacggtcgagcaggccgttgcgcttgcgacagacccggcgcggccggcaagcttttcg
ccggtgctgatcatgagccatctcgtcagcgccgacgatccggaccatcggctgaatggc
cttcaactccgtcgcttccatgaggtgtcgactgcctatgaaggggtcgatgcgagcctt
gccaactccggcggcgtcttcctcgggcccgactatcatttcgacctgacccggccgggc
atcgccgtctatggcggcgaggcggtgaacgacatccccaacccgatgaagccggtggtg
accgccgaagcacggatcatccaggtgcgcgacgtggccgccggcggcaccgcgagctat
ggcgcctctgcccgcttcgaccgcgacagtcgcatcgccacggtggctgtgggatatgcc
gatggctatcaccgttccgtgtccggcggcggcgtcacgctcaggcaggcaacgccatca
ggggccttcggtttcctgcacggccagaaggtcccgcatgtcgggcgcgtcaccatggac
ctcagtctcttcgacgtcacggaccttcctgaaagcgcggtacgaccgggtgattacatc
gagctcttcggccggcacatcgccatcgacgatgtcgcgcgcgccggagggacgatcggc
tacgagatgctgaccagtctcggccgccgctatatcaggcactatatcgacagcgtctga

DBGET integrated database retrieval system