KEGG   Exiguobacterium antarcticum: Eab7_1664Help
Entry
Eab7_1664         CDS       T02258                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00473  D-Alanine metabolism
ean00550  Peptidoglycan biosynthesis
ean01100  Metabolic pathways
ean01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Eab7_1664 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Eab7_1664 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Eab7_1664 (ddl)
Enzymes [BR:ean01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Eab7_1664 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ean01011]
 Precursor biosynthesis
  Amino acid ligase
   Eab7_1664 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp RimK ATP-grasp_4 GARS_A ATPgrasp_ST ATPgrasp_Ter TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFS70773
UniProt: K0ABA3
LinkDB All DBs
Position
complement(1620465..1621409)
Genome map
AA seq 314 aa AA seqDB search
MKVAVLFGGISGEREVSLNSGKSVIEALESKGHDVIAVDFHPERAEDILNLRVEVAVIAL
HGKFGEDGRVQALLEMAGIPYTGSGVLASALAMDKARSKVHFEKAGIRIARDVLIERGDD
IEQKIASWNGQFPCVVKPAQEGSSNGLTIAMDEQMLRQGIDLAFTADEAVLIEQFIKGRE
VTVPVLGTKGEEKALPVIEIIPKNEFYDYESKYAIGGSEHICPAQFDEATTQTLQDWAVL
AHQVLGCAGYSRTDFLVPESGQPVILETNTLPGMTATSLFPDGARAVGIDYPELVETFIE
LAISRHQSGTENKK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggcagtattgtttggcgggatctctggtgaacgtgaagtttcattaaatagc
gggaagtccgtaattgaggcactagaaagcaaagggcacgatgtcatagccgtcgatttt
cacccagagcgtgcggaagacatcttgaatctaagagtagaagtggctgtcatcgcactt
catggtaagtttggtgaggacggtcgtgttcaagcgttacttgagatggcgggaattccg
tatacaggatctggtgtgttggcttcagcactagcgatggacaaagcacgttcgaaagtt
catttcgaaaaagcgggcatccggatcgcacgtgatgtattgattgagcgtggtgacgat
attgagcagaaaatcgcttcgtggaacggtcagttcccatgtgtcgtcaaaccagcacaa
gaaggatcctcaaatggcttgacgatcgccatggatgaacagatgcttcgtcaaggaatt
gaccttgcatttacggcggatgaagcagttttgattgaacaattcatcaagggtcgtgaa
gtgaccgtccctgtgctcggtactaagggtgaagaaaaagccttgccggtcatcgaaatc
attccgaaaaatgaattttatgattatgaatcgaaatatgcaatcggtggatcggaacat
atttgtccggcacaatttgacgaagcgacgacgcagacgttacaagactgggcggttctt
gcgcatcaagtactcggttgtgcaggctattcgcggacggacttccttgtgccggaatca
ggacaacctgtgattttagaaacgaatacgttgcccggcatgacggcaacaagtttattc
ccagacggtgcacgtgctgttgggatcgactatccagaactcgtggagacgtttattgaa
ctggcaatttctcggcaccagagcgggactgagaacaaaaaataa

DBGET integrated database retrieval system