KEGG   Enterobacter asburiae LF7a: Entas_0212Help
Entry
Entas_0212        CDS       T01604                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
eas  Enterobacter asburiae LF7a
Brite
Translation factors [BR:eas03012]
 Eukaryotic Type
  Elongation factors
   Entas_0212
 Prokaryotic Type
   Entas_0212
Mitochondrial biogenesis [BR:eas03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Entas_0212
Exosome [BR:eas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Entas_0212
  Exosomal proteins of breast cancer cells
   Entas_0212
  Exosomal proteins of colorectal cancer cells
   Entas_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
226872..228056
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GEAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggcaaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacttcccacgttgaatacgacaccccgactcgccactacgcacacgta
gactgcccaggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggtagttgctgcgactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttcctttcatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggtagaaatggaagttcgtgaacttctgtctcag
tacgatttcccaggcgacgacactccaatcgttcgtggttcagctctgaaagcgctggaa
ggcgaagcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccagaaccagagcgtgcgattgacaagccattcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagttggt
gaagaagttgaaatcgttggtatcaaagagactgcgaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggcgaagccaggctcaatcaag
ccacacaccaagttcgaatctgaagtgtacattctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacatcaagatggtt
gtgactctgatccacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagttctcggctaa

DBGET integrated database retrieval system