KEGG   Enterobacter asburiae LF7a: Entas_1834Help
Entry
Entas_1834        CDS       T01604                                 

Definition
(GenBank) Glutathione S-transferase domain-containing protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Entas_1834
Enzymes [BR:eas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Entas_1834
Transporters [BR:eas02000]
 Other Transporters
  Pores ion channels [TC:1]
   Entas_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1976652..1977257)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFFAINPKGQVPALLLDDG
TLLTEGVAIMQFLADNVPDRQLLAPTGSISRYKTLEWMNYIATELHKGFTPLFRPDTPED
YKPTVRALLEKKLQYINESLKDDQWICGQRFTIADAYLFTVLRWARAVKLNLEGLDHIAS
YMERVAARPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcctgctctcttgcttcccatattaccctgcgcgag
agcggtaaagatttcacgctggacggcgttgatctgatgaaaaaacgcctggaaaacggc
gacgatttctttgctattaacccgaagggacaagttccggcgctgctgctggatgacggt
acactgctgacagaaggcgttgccattatgcagttcctggcggataacgtaccggaccgc
cagctgttggccccgactggcagtatctctcgctataagacgctggagtggatgaactat
atcgcgaccgagctgcacaaaggctttacgccgctgttccgcccggatacaccagaagac
tacaaacctaccgtgcgtgccctgctggagaaaaaacttcagtacattaacgagtcgttg
aaagacgatcagtggatttgtggccagcgtttcaccattgcagatgcgtatctgtttacc
gttctgcgctgggcacgtgcggttaagcttaacctggaagggttagatcatattgcatcg
tatatggagcgggtggcagcgcgccctgcggttgctgcggcgctgaaagcggaaggtctt
aactaa

DBGET integrated database retrieval system