KEGG   Enterobacter asburiae L1: DI57_13965Help
Entry
DI57_13965        CDS       T03084                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eau  Enterobacter asburiae L1
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eau00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DI57_13965
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DI57_13965
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DI57_13965
Enzymes [BR:eau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DI57_13965
Peptidoglycan biosynthesis and degradation proteins [BR:eau01011]
 Precursor biosynthesis
  Amino acid ligase
   DI57_13965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2946235..2947335
Genome map
AA seq 366 aa AA seqDB search
MAKQRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVNDASQYLLN
AHDPAHIALNPSEVSVATVPGVVKGQLIDAGNAQALAQIDVVFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFVTLTRANRDKHSFAQISGELGL
PLFVKPANQGSSVGVSKVTSEAEFTQAVRLAFEFDHKVVVEQGIKGREIECAVLGNDFPQ
ASTCGEVVLNSDFYSYDTKYIDDKGAQVVVPADIDPAINDKIRAIAIRAYQTLGCCGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLSYPELITRLIELALERHAADSAL
KSSVNG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcagcgcgtaggtattgtctttgggggaaaatcagcggagcacgaagtgtca
ttgcaatcggccaaaaatatcgttgatgcgatcgataaaagccgcttcgacgtggtgctg
ctgggcattgataaacagggccagtggcacgttaacgatgccagccagtatctgctgaat
gctcacgatccggcgcatatcgcccttaatccttcggaagtgagcgtcgccaccgtaccc
ggcgtcgtgaaggggcagctcatcgacgccggcaacgcgcaggctctcgcccagatcgac
gttgtcttccctatcgttcacggcaccctgggcgaagatggttccctgcagggaatgctg
cgcatggccaacctgccgttcgtcggctcggacgtactcggctctgccgcgtgcatggac
aaagacgtcacaaaacgcctgctgcgcgatgccgggctgaacattgcgccattcgtgacc
ctcacccgcgccaaccgcgacaagcacagcttcgcgcaaattagcggagagctgggtctg
ccgctgtttgtgaagcctgcaaaccagggctcctccgtgggcgtcagcaaagtcaccagc
gaagcagagttcacgcaggccgtccgtctggcgtttgagttcgaccataaagtggtggtt
gagcagggtattaaaggccgtgaaattgagtgcgccgtgctgggcaacgatttcccacag
gcgagcacctgcggcgaagtggtcttaaacagcgacttctactcgtacgacaccaaatac
attgatgataaaggcgcgcaggttgtcgttcctgcggatatcgatccggcgattaacgat
aagatccgggcgatcgccattcgcgcttatcagacgctcggctgctgcggcatggcgcgc
gtggatgtgttcctgacgccggaaaacgaagtggtgatcaatgaaatcaacacgctgccg
gggttcactaacatcagcatgtacccgaaactgtggcaggccagcggcctgagctatccg
gaactgatcacccgcctgatcgagctggctctggagcgtcacgccgccgacagcgcgctt
aaaagttccgtaaacggttaa

DBGET integrated database retrieval system