KEGG   Aromatoleum aromaticum: ebA5705Help
Entry
ebA5705           CDS       T00222                                 

Definition
(GenBank) CoA ligase, AMP generating (three fragments in different reading frames)
Organism
eba  Aromatoleum aromaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
join(3382028..3382525,3382527..3383216,3383218..3384525)
Genome map
AA seq 831 aa AA seqDB search
MLGDAETVRDLIRALEQVGLGAAPAEAPHAQQPQPGRAEGRPDSAADLVEALQWQVGRNP
DRDHVLFYRGDAEQAGEPERLGYAALAADATRIAGGLVRRGVVPDQCVALMLPSGLDFFR
CFFGVLFAGAIPVPMYPPARASQIEDHLRRQAGILRNCEAPVLVAFMRPLLRVLGGLAPS
LRHIVTAEELADAPDATPLPARSEAALVQYTSGSTGDPKGVTLSHANLLANIRAYGRVLN
VSSTDVCVSWLPLYHDMGLIGAWLGSLYHACPLVLMSPLDFLARPECWLWAIHRHRGTIT
AAPNFAFELCVKRLGDRDLAGLDLASWQIAMNGAEPVSAGTLERFADAFGRYGLRREILA
PVYGLAECSLALTMTPPGRGMRTDRIERAAMTHAGRRSPAGGDTPSVDVVSCGLPLPGHE
VRIVGADGRMLPERRIGQLEFRGPSATAGYFRNPAADAALFHDGWLDTGDFAYLVDGELY
VTGRAKDMIIRGGRNFYPYELEQAVGELPGVRKGCVAAFGVPDAAPAGERLVVVAEMREK
DAAARQALEQRIVAVSSDVLGLPADEVVLVPPHAVLKTSSGKIRRGAIREGYRHGTLGTG
NRPRWVQVLRMAASGARARAGAAASGIAALVHGAWVWAWLAVLGGCAAVAVLLLPTLAQR
WACCHALARLFGHLGGCPVEVSGLDSLPSGHCVFVANHASYVDGIILTAALPRPVAFVVK
AELQRNRVLHVLLGRLGARFVERFDSRRSVEDARALGEAARKSPPLLFFAEGTIRREAGL
LPFRLGAFQVAAQSNLPIVPLALMGTRDVLPSDSWLPRRGHRPRRRGRWGG
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggcgacgccgagacggtgcgcgacctgatccgcgcgttggagcaggtcggactc
ggtgctgcgccggcagaggcgccacacgcgcagcagccgcagcccgggcgggcggaaggg
cggcccgactcggcggcggacctggtcgaagcactgcaatggcaggtcggacgcaatccg
gaccgcgatcacgtgctgttctaccgtggcgacgcggagcaggcaggcgagccggaacgg
ctcggctacgccgcgctcgcggcggacgcaacccgcatcgccggcgggctcgtccgccgc
ggagtcgtgccggaccagtgtgtcgcgctgatgctgccttcgggcctggatttcttccgc
tgcttcttcggcgtgctgttcgccggcgcgattccagtgccgatgtacccgccggcccgc
gcgagccagatcgaggaccacctgcgccgccaggccggcatcctgaggaattgcgaggcg
ccggtgctcgtcgcgttcatgcggccgctgctgcgggtcctcggcgggctcgcgccgtcg
ctgcggcacatcgttaccgcggaggagcttgccgatgcaccggacgcgacgccgctgccg
gcgcgcagcgaggctgcgctcgtgcaatacacctccggctcgaccggcgatccgaagggc
gtgacgctgagccatgcgaatctgctcgcgaacatccgcgcctatggccgcgtgctgaat
gtgtcctcgaccgacgtgtgcgtgagctggctgccgctctatcacgacatggggctgatc
ggcgcatggctgggcagcctgtatcacgcctgtcccctcgtcctgatgtcaccgctggat
tttctcgcgcggcccgagtgctggctgtgggcgatccatcgccatcgcggcacgatcacg
gccgcgccgaatttcgcgttcgagctgtgcgtgaagcgtcttggcgaccgggatcttgcg
ggcctcgacctcgcgtcgtggcagattgcgatgaacggcgcggagccggtcagcgccggt
acgctggaacgcttcgccgacgcgttcgggcgatacggtttgcgccgcgagatcctggcg
ccggtctatggcctcgccgaatgctcgctcgcgctgacgatgacgccgcccggccgcggc
atgcgcacggaccgcatcgagcgtgcagcgatgacgcacgcgggccgtcgcagccccgcg
gggggcgatacgccgtcggtggacgtcgtctcctgcggcttgcccctgcccggccacgag
gtgcgcatcgtcggcgccgacggccgcatgctgcccgagcgccgcatcggacaactggag
tttcgcgggccgtcggcaacggccgggtatttccgcaatccggccgccgacgcggcgctg
ttccacgacggctggctcgacacgggggacttcgcgtatctcgtcgacggcgagctctac
gtgaccggccgcgccaaggacatgatcatccgcggcgggcgcaacttctatccgtacgaa
ctggagcaggcggtcggcgagctgccgggcgtgcgcaagggctgcgtcgcggcgttcggc
gtgccggacgcggcgccggccggcgagcggctggtcgtcgtcgccgagatgcgggagaag
gacgccgcggcacggcaggcgctggagcagcgcattgtcgcagtgtcgtcggacgtgctc
ggtctgccggctgacgaggtggtgctcgtgccgccgcacgcggtgctcaagacgtcgagt
ggcaagatccgccgtggcgcgatccgcgaaggctaccggcacggcacgctgggcacgggg
aaccggccgcggtgggtgcaggtgctgcgcatggcggcgtcgggtgcgcgggcgagggcg
ggcgcggcggcgagcggcattgccgcgctggttcatggcgcatgggtgtgggcttggctc
gcggtgctcggcggctgcgccgcggttgcggtcctgttgctgccgacgctcgcgcagcgc
tgggcgtgctgccatgcgctggcgcggctgttcggccatctcggggggtgcccggtcgag
gtgtcggggctggacagcttgccgtccggccattgcgtgttcgtcgcgaaccatgcaagc
tatgttgatggcatcatcctgaccgcggcgctgccgcggccggtcgcgttcgtcgtcaag
gccgagctgcagcgcaatcgggtgctgcatgtgctgctcggccgcctgggggcgcgcttc
gtcgaacgtttcgactcgcgccgcagcgtcgaggatgcccgcgcgctcggcgaagccgcg
cggaagtcgccacccttgctgttcttcgccgaaggaaccatccggcgcgaggcgggcctg
ctgccgttccgcctcggcgcgttccaggtcgcggcacagtcgaacctgcccatcgtgccg
cttgcgctcatgggaacgcgcgacgtgctgccgagcgattcctggttgccgcgccggggg
cacagaccacgtcgaagaggtcgatggggcgggtga

DBGET integrated database retrieval system