KEGG   Erwinia billingiae: EbC_37170Help
Entry
EbC_37170         CDS       T01270                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ebi  Erwinia billingiae
Brite
Enzymes [BR:ebi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     EbC_37170
Lipid biosynthesis proteins [BR:ebi01004]
 Acyl-CoA synthetase
  Unknown
   EbC_37170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4132440..4134173)
Genome map
AA seq 577 aa AA seqDB search
MSETRSTHSLPMRYADFGSLVEALDYAAQGSTGMNFYDRRNQLVSVLEYRTLKERAISGA
RRLLSLDLKKGDRVALIAETSVGFVEAFFACQYAGLVAVPLAIPMGIGQRASYIVKLKGL
ISSCAPAAIISSDEWVPLISSATENAPPPHILSNAEFNALPERDIALTKPSADDIAYLQY
TSGSTRFPRGVIITQRSVMANLQVISHDGIKLRAGDRCVSWLPFYHDMGLVGFLLTPVAT
QLSVDYLRTQDFAMRPLQWLKLIDKNRGTVTVAPPFGYDLCLRRSNMKELAGLDLSSWRV
AGVGAEPIPAELLKQFGEHFSDLHFDPDAFMPCYGLAENTLAVSFSEENAGAQIHEIDRE
VLEYEGRAVAPGKNTLATSSFVNCGKALPGHRIDIRSENGSVLPEHQVGHIYIAGPSLMN
GYFRDDVSQQMIKATGWMDTGDLGYLSGGNLYVTGRKKDLIIIRGRNIWPQDIEYVAEAE
PEIHAGDAIAFVTEEHGEGARIILQIQCRIGSEERREQIVHSLSASIQSEFGVAVDIELL
PPHSIPRTSSGKPARAEAKKRWLSAALYPAVQLAGLA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacacgctcaactcactctcttcctatgcgctatgccgattttggctctctg
gtggaggcgttagattacgccgcccaggggagcacaggaatgaacttctacgaccggcgt
aatcaactggtttccgtgctggaataccggacgctcaaagagcgggcgataagcggcgct
cgtcgtttgctgtcgctggatctgaaaaaaggcgaccgcgttgcgctgatcgcagagacc
agcgtcggttttgtcgaagcgttctttgcctgccagtatgccggcttagtcgcggttccg
ttggccattccgatgggcatcggccagcgggcgtcgtatatcgtcaagctgaaaggattg
atttccagctgcgcgccggcggcgattattagcagtgacgagtgggtgccgttaatcagc
tcagccacagagaatgcaccgcctccgcatattctcagcaatgccgaattcaatgccctg
ccggaacgggatattgcgttaacaaaaccgtccgccgacgatattgcctacctgcaatat
acctccggcagcacgcgtttcccgcgcggcgtgattattacccagcgttccgtgatggcc
aatctgcaggttatcagccatgacggcattaaattacgcgctggcgaccgctgcgtgtcc
tggctgccgttttatcacgatatggggctggtcggttttctgctaacgccagtggcgacg
cagctttcagtggattatctgcggacgcaagatttcgccatgcggcctttacagtggtta
aagctgatcgataaaaaccgtggcacggtcaccgtcgcgccaccttttggctacgatctg
tgcctgcgtcgcagcaacatgaaagagctggccgggctggatctttccagctggcgcgtg
gccggcgtcggcgcggaacctattcctgccgagctgcttaagcagttcggggagcatttc
agcgatcttcatttcgaccctgacgcttttatgccttgctacggcttagctgaaaacact
ttggcggtgagtttctcggaagagaacgccggtgcgcaaattcatgagatcgaccgcgaa
gtgctggaatacgaaggccgcgccgtcgcgccaggcaaaaatacgctggccacctcctca
tttgtgaattgcggcaaggcgttgcctggtcatcgcattgatattcgcagtgagaatgga
tcggtgttgccggaacatcaggtcgggcatatttatatcgccggccccagcctgatgaac
ggttatttccgtgacgatgtctcgcagcaaatgatcaaggcgacgggctggatggatacc
ggcgatttgggttatctgtcaggcggaaacctttacgtcaccggccgcaagaaagactta
attattattcgtggccgtaatatctggccgcaggatattgaatacgttgccgaagcggag
ccggaaattcacgccggcgatgcaattgcgtttgtcaccgaagagcacggcgagggcgcc
agaattattttgcagatccagtgcaggatcggttctgaggagcgccgtgagcaaattgtt
cactcgctgtcggccagcattcaaagcgaattcggcgtggcggtggatatcgaacttttg
ccgcctcacagtattccacgcacttcctcgggtaaaccggcgcgagcagaagccaaaaag
cgctggttatccgccgccctttatcctgctgtgcagttggctgggctggcctga

DBGET integrated database retrieval system