KEGG   Equus caballus (horse): 100034087Help
Entry
100034087         CDS       T01058                                 

Gene name
PTGS1, COX-1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ecb  Equus caballus (horse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100034087 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100034087 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100034087 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    100034087 (PTGS1)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100034087 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
25
AA seq 599 aa AA seqDB search
MSRQSLWLRFPLFLLLLPSLVLPADPRAPALVNPCCYYPCQHKGICVRFGLDHYQCDCTR
TGYSGPNCTIPELWTWLRNSLRPSPSFLHFLLTHGRWFWEFVNATFIRDMLMRLVLTVRS
NLIPSPPTYNVAHDYISWESFSNVSYYTRVLPSVPQDCPTPMGTKGKKQLPDAQLLSDRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YHLRLFKDGKLKYQMLNGEMYPPTVEQAPVLMHYPRGIPPQNQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKTEHPTWDDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVHFQYRNRIAMEFNHLYHWHPLMPDSFRVGSQEYSYKQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNLDHHVLHVAVDVIKESRELRLQPFNEYRKRFGMKPYASFQEL
TGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEMGFNIVKTATLKKLVCLNTNTCPYVSFRVPKRPQDDGPGVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagagtctctggctccggttcccgctgttcctgctgctgctgccgtcccta
gtcctgcccgcggaccccagggcgccggcgctagtgaacccctgttgttactacccatgc
cagcacaagggtatctgtgtccgcttcggccttgaccactaccagtgtgactgcacccgc
acgggctactccggccccaactgcaccatccctgagctatggacctggctccggaattca
ttgcggcccagcccctccttcctccacttcctgctgacacatgggcgctggttctgggaa
tttgtcaacgccaccttcatccgtgacatgctcatgcgcctagtactcacagtgcgttcc
aaccttatccccagcccccccacctacaatgtagcacatgactacatcagctgggagtcc
ttctccaatgtgagttattacactcgtgtgctgccctctgtgccccaagactgtcccacg
cccatggggaccaaagggaagaagcagctgccagatgcccagctcctgagcgatcgcttc
ctgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggccacatttatggagacaatctggaacgtcag
tatcacctgcggctctttaaggatgggaaactcaagtaccagatgctgaatggagagatg
tacccgccaacggtggaacaggcgcctgtgttgatgcactacccacggggtattccaccc
cagaaccagatggccgtgggccaggaggtgtttgggctgcttcctgggctcatgctctat
gctacgctctggctacgcgagcacaaccgtgtgtgcgacctgctgaagactgagcacccc
acctgggatgatgagcagctcttccagacggcccgcctcatcctcatcggggagaccatc
aagatcgtgattgaggagtacgtgcagcagctgagcggctacttcctgcagctgaagttt
gacccggagctgctcttcggcgtccacttccagtatcgcaaccgcattgccatggagttc
aaccacctctaccactggcacccactcatgcctgactccttcagagtgggctcccaggag
tacagctataagcagttcctgttcaacacctccatgctggtggactacggggtcgaggcc
ctggttgacgccttttctcgccagatcgctggccggatcggtggaggtaggaacctggac
caccatgtcctgcacgtggctgtcgacgtcatcaaggaatcccgagagctgcggctgcag
cccttcaatgagtaccgcaagaggtttggcatgaagccctacgcctctttccaggagctc
actggagagaaggagatggcagctgagttggaggagctgtatggagacatcgatgccttg
gagttctaccctgggctgcttctcgagaagtgccatccaaactccatctttggggagagt
atgatagaaattggagctcccttctccctcaagggcctcctaggcaatcccatctgttct
ccggagtactggaaaccgagtacatttggtggtgaaatgggcttcaacattgtcaagacg
gctacgctgaagaagctggtctgcctcaacaccaacacttgtccctatgtttccttccgt
gttcccaagcgcccccaggatgatgggcctggtgtggagcggccttccacagagctctga

DBGET integrated database retrieval system