KEGG   Equus caballus (horse): 100064801Help
Entry
100064801         CDS       T01058                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X2
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04614  Renin-angiotensin system
ecb04924  Renin secretion
ecb05142  Chagas disease (American trypanosomiasis)
ecb05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100064801 (ACE)
   04614 Renin-angiotensin system
    100064801 (ACE)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100064801 (ACE)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100064801 (ACE)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100064801 (ACE)
Peptidases [BR:ecb01002]
 Metallo Peptidases
  Family M2
   100064801 (ACE)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100064801 (ACE)
CD molecules [BR:ecb04090]
 Proteins
  100064801 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100064801
NCBI-ProteinID: XP_001495639
Ensembl: ENSECAG00000012910
UniProt: J7ILL4
LinkDB All DBs
Position
11
AA seq 1313 aa AA seqDB search
MGAASGRRGPEPPPPPLPPLLLLLPLLLPPPPPTLALDPALQPGNFTADEAGAQLFAQSF
NSSAEQVLFQSSAASWAYVTNITQENARRQEDAALLNQEFAEVWGQKCKELYDPIWQNFT
DPILRRVISGVRILGPANLPLKKRQQYNSLLSNMNRIYSTAKVCYPNKTATCWSLDPELT
NILAVSRSYALLLYAWEGWHNTVGIPLKPLYQDFTALSNEAYKLDGFSDTGAYWRSWYES
PTFMEDLEHLYHQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWDNI
YDMVVPFPDKPNLDVTSAMVQKGWNATHMFWVAEEFFTSLGLLPMPPEFWAESMLEKPSD
GREVVCHASAWDFYNRKDFRIKQCTRVTLEQLSTVHHEMGHVQYYLQYKDQPVSLRQGAN
PGFHEAIGDVLALSVSTPTHLYKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQ
WRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVLRNETHFDAGAKFHVPNVTPYIRYFVS
FILQFQFHQALCKEAGHQGPLHQCDIYQSTQAGAKLRELLQAGSSRPWQEVLKDMIGSDA
LDAQPLLNYFQPVSQWLQEQNQQNDEVLGWPEYQWYPPMPDNYPESIELVSDEAEASKFV
EEYDRRSQVVWNEYAEANWNYNVNITTEASKILLQQNIQMANHTVKYGTWARQFDVTNFQ
NTTMKRMIKKIQDLERAALPVKELQEYNKILLDMETTYSVASVCLANGTCLQLEPDLTNL
MATSRKYEELLWAWQGWRDNVGRSILPFFPKYVELFNKAARLNGYVDAGDSWRSMYEMPS
LEQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHVNLEGPIPAHLLGNMWAQTWSNIYD
LVVPFPSAPKMDATEAMIKQGWTPRRMFEEADNFFTSLGLLPVPPEFWNKSMLEKPTDGR
EVVCHASAWDFYNGKDFRIKQCTAVNMEDLVVAHHEIGHIQYFMQYKDLPVTFREGANPG
FHEAIGDVLALSVSTPKHLYNINLLSSEGGGYEQDINFLMKMALDKIAFIPFSYLVDQWR
WRVFDKSITKENYNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYIRYFVSFV
IQFQFHEALCQAAGHKGPLHKCDIYQSKEAGKRLADAMKLGFSKPWPEAMKLITGQPNMS
ASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPNSARSEASFLGTGRVNFLGLNLEEQ
QARVGQWMLLFLGVALLVATLGLTQRLFSIRQYSLRQPHRGPQFCSEVELRRS
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggccgccgggggccggagccaccgccgccaccgctgccgccgctg
ctgctgctgctgccgctgctgctgccaccgccgccgcccaccctggcactcgaccccgcg
ctgcagcccggaaactttaccgcggacgaggccggggcgcagctcttcgcgcagagcttc
aactcgagcgccgagcaggtgctgttccagagctcggccgccagctgggcgtacgtcacc
aacatcacccaggagaacgcgcggcgccaggaggacgcagccttgctcaaccaggagttt
gccgaggtctggggccagaagtgcaaggagctgtacgacccaatctggcagaacttcacc
gacccgatattgcggagggtcatcagtggtgtgcgcatcctgggccctgccaacctgccc
ctgaagaagcggcagcagtacaactctctgctaagcaacatgaacaggatctactccact
gccaaggtctgctaccccaacaagactgccacctgctggtccctggacccagagctcacc
aacatcctggctgtctctcgaagctatgccttgctgctctatgcctgggaaggctggcac
aacactgtgggcatcccgctgaaacccctgtaccaggacttcactgccctcagcaatgag
gcctacaagctggatggcttctcagacacaggggcctactggcgctcctggtatgagtcg
cccaccttcatggaggatctggagcacctctaccatcaattagagcccctctacctcaac
ctgcatgcctacgtccgccgcgcactgcaccgccggtacggggacagatacatcaacctc
aggggacccatccctgctcacttgctgggggacatgtgggctcagagctgggacaacatc
tacgacatggtggtgcctttccctgacaagcccaatctcgacgttaccagtgctatggtg
cagaagggctggaatgctacgcacatgttctgggtggccgaggaattcttcacttccctg
gggctcttgcccatgcctcctgagttttgggcagagtctatgctggagaaaccaagcgac
gggcgtgaagtggtttgccacgcttctgcctgggacttctacaacagaaaagacttcagg
atcaagcagtgcacacgggtcactctagagcagctgtccacggtgcaccacgagatgggc
cacgtgcagtactacttgcagtacaaggaccagcccgtctccctgcgccaaggcgccaat
cctggcttccacgaggccatcggagatgtgctagcactgtctgtctccacccctacacat
ctgtacaaaattggcttgctggaccgtgtcaccaatgacacggaaagcgacatcaattac
ttgttaaagatggcactggaaaaaattgccttcctgccgtttggctacttggtggaccaa
tggcgttggggggtctttagtgggcgtacccccccttcccgctacaactttgactggtgg
tatcttcgaaccaaatatcaggggatctgtcctccagttctccgaaacgaaacccacttt
gatgctggagcaaagtttcatgtcccaaatgtgacaccgtacatcaggtactttgtgagt
tttatcctgcagttccagttccatcaagccctgtgcaaggaggcaggccaccagggccca
ctgcaccagtgtgacatctaccagtccacccaggcgggggccaagctccgggagttgctg
caggcaggctcctcacggccctggcaagaggtgctgaaggatatgattggctcagatgcc
ctggacgctcagccactgctcaactacttccagccggtcagccagtggctacaggagcag
aaccagcagaatgacgaggtcctaggctggccagagtatcagtggtacccaccgatgccc
gacaattacccagagagcattgagctggtgagtgatgaggctgaggccagcaagtttgtg
gaggaatatgaccggagatcccaagtggtgtggaacgaatatgccgaggccaactggaac
tacaacgttaacatcaccacagaggccagcaagatcctgctgcagcagaacatacagatg
gcaaaccacactgtcaagtatggcacctgggccaggcagtttgatgtgaccaacttccag
aataccaccatgaagcggatgataaagaagattcaggacctagagcgggcagcgctgcct
gtcaaggagctgcaggagtacaacaagatcctgctggacatggaaactacttacagcgtg
gcctctgtgtgcctcgccaatggtacttgtctacagctagagcctgatctgacgaatctg
atggccacatcccggaaatatgaagaactgttgtgggcatggcagggctggcgagacaat
gtggggaggtccatcctccctttttttccaaaatacgtggagctcttcaacaaggctgcc
cggctcaatggctatgtagacgcaggggactcgtggagatctatgtacgagatgccgtcc
ctggagcaagacctggagcagctctaccaggagctgcagccgctctacctgaacctgcac
gcctacgtgcgccgggccctgcaccgccactacgggccacaacacgtcaacctggagggc
cccattccagctcatctcctggggaacatgtgggcgcagacctggtccaacatctatgac
ttggtggtgcctttcccttcagcccccaagatggatgccacagaagccatgataaagcag
ggctggacacccagaaggatgtttgaggaagcggacaatttcttcacctccctgggactg
ctgcctgtgccccctgagttctggaacaagtccatgctagagaagccaactgatggacgg
gaggtggtatgccatgcctctgcctgggacttctacaatggcaaagacttcaggatcaag
cagtgcactgctgtgaatatggaggacctggtggtggctcaccacgaaataggccacata
cagtatttcatgcagtacaaggacttgcctgtgaccttccgggagggtgccaaccctggc
tttcatgaggccattggggacgtgctggcactctcagtgtctacccccaagcacctatac
aacatcaacctgctgagtagcgagggtggtggctacgagcaagatatcaactttctgatg
aagatggcactcgacaagattgcctttatcccgttcagctaccttgttgaccagtggcgc
tggagagtgtttgacaaaagcattactaaggagaattacaaccaggaatggtggagcctc
aggctgaagtaccagggcctctgccctccagtagccaggtctcaaggtgactttgaccca
ggggccaaattccacattccttcaagtgtgccttatatcaggtactttgtcagctttgtc
atccagttccaattccacgaggcactgtgtcaggcagctggccacaagggccccctacac
aagtgtgacatctaccagtccaaggaggcagggaagcgcctggcggacgccatgaagctg
ggcttcagtaagccatggcccgaagccatgaagctaatcacgggccagcccaacatgtca
gcctcagccatgatgaactacttcaagccgctgctggactggctcctcactgagaacggg
cggcacggggagaagctgggatggccacagtacaactggacaccaaactctgctcgctcg
gaagcctccttcctgggcaccggccgtgtcaacttcctgggcttgaacctggaggagcag
caggcccgtgtgggccagtggatgctgctcttcctgggcgtcgccctgctggtggccacc
ttgggtctcacccagcggctcttcagcatccgccagtacagcctccgccagcctcaccgt
gggccccagttctgctccgaggtggagctgagacgctcctga

DBGET integrated database retrieval system