KEGG   Equus caballus (horse): 100070842Help
Entry
100070842         CDS       T01058                                 

Gene name
TGM5
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100070842 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
1
AA seq 719 aa AA seqDB search
MAQGLEVALIDLQSSWNNVRHHTEEISSERLLVRRGQAFNITLYFRNRGFQPALDNLIFV
VETGPLPDLAKGTRAIFSLASRHGPSPWIASLETNGAASLEVSLCAPPTAAVGRYLLKVH
LNSFQGSVMAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLHFQIDPAIDCALRGSPVYISRVVCAMINSNDDNGVLNG
NWSENYFDGINPVEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNFHVWNECWMARKDIPPGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMSWLVYGGKEQKLHQDT
NSVGNFISTKSIQSDERDDITENYKYPEGSPQEREVFLKALLKLKARRSPGSHRAASQPS
RPRSLSGDGPRSLDTPSLRPSDVVQVSMKFQLLDPPNMGQDIRFVLLTLNMSLQFKDLKV
NLSAQSLLHDGSPLPPFWQDTAFITLSPEEAKTYPCKIPYSQYSQYLSTDKLIRISALGE
EKSSPEKILVNKIITLAYPGIMINVLGEAVVNQPLSIQVIFSNPLLEPVADCELTVEGSG
LFKKQQRVLIGVLKPQHRASITLETVPFKSGQRQIQANLRSNKFKDIKGYRNIYVDSRL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagggttggaggtggccctcatagacctccagagctcctggaacaatgtgcgg
caccacactgaggagatcagctctgagcgcctccttgttcgccggggccaggccttcaac
atcactctgtacttcagaaaccggggcttccagccagccctagacaacctcatcttcgtg
gtggagactggaccgctgccagacctggccaaggggacccgagccatattcagcctggca
agtcgccatgggcccagcccctggatagcctcgctggaaaccaacggggccgcctccctg
gaggtgagcctgtgtgcccctcccacagcagctgtcggtcgatacctcttgaaggttcac
ctcaattccttccaggggtctgtcatggcctaccagcttggggagttcattctgctcttc
aatccctggtgcccagaggacgctgtctacctggacagtgagccccagaggcaggagtat
gtcgtgaatgattacggcttcatctaccaagggaacaagaactggatccgcccatgcccc
tggaactacggacagtttgaagagaatatcatagacatctgcctggagctgctagacaag
agcctgcacttccagatcgacccagccatagactgtgccctgcggggaagccccgtctac
atcagcagagtggtgtgtgccatgatcaatagcaatgatgacaatggggtgctcaatgga
aactggagtgagaattactttgatggcatcaaccctgtggagtggactggcagcgtggcc
atcttgaagcagtggcatgccacaggctgccagcccgtgcgctacgggcagtgctgggtc
tttgccgctgtcatgtgcacagtgatgcggtgcctggggatccccacccgtgtgatcacc
aactttgactctggccacgacacggatggaaacttgatcatagatgagtattacgacaac
acaggcaggattttggagaataagaagaaggacactgtctggaatttccacgtctggaat
gagtgctggatggcccgaaaggacatccctcccggatatggaggctggcaggtgctggat
gccacaccccaggagacgagcaacggcctctactgctgcggccccgcctcggtcagagcc
atcaaagagggggaggtggacctgaactacgacacggcctttgccttttccatggtgaat
gctgactgcatgtcctggcttgtctacggagggaaggagcagaaacttcaccaggacaca
aattctgttggcaattttatcagcaccaagagcatccagagtgatgagcgggatgacatc
accgagaactacaagtacccagaaggctccccacaggagagggaggtgtttctgaaggct
cttctgaagctgaaggctagaaggtccccaggctcccaccgagcggcctcacaaccttcc
aggcccaggtccctgagcggggatggtcctcggagcctggatacaccttcccttcggccc
agtgatgttgtccaggtctccatgaaattccagctgctcgacccacccaacatgggccag
gacataaggtttgtcctgctgaccctcaacatgtcactccagttcaaggacctcaaagtg
aacttgagtgctcagtctctgctgcatgatggcagccccctgccgccgttctggcaggac
acagccttcatcacactctctcctgaagaagcaaagacctatccctgcaaaatcccctat
tcccagtacagccagtacctgtcaacagacaagctgatccgcatcagtgccctgggcgaa
gagaagagcagtcctgagaagatcctggtgaacaagatcatcaccttagcctatccaggc
atcatgattaatgttctaggagaagccgttgtgaaccagccgctctccatacaggtgata
ttttcaaatccactcttggagccggttgcagactgtgagctgacagtggaaggaagcggt
cttttcaagaaacaacaaagagtcctcattggagttctcaaaccacaacacagagccagc
atcactctggagactgtccccttcaagagtggccaaaggcagatccaagccaatctgagg
agcaacaagtttaaggacatcaagggttacaggaacatctatgtagactccaggttataa

DBGET integrated database retrieval system