KEGG   Equus caballus (horse): 100072686Help
Entry
100072686         CDS       T01058                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100072686 (HKDC1)
   00051 Fructose and mannose metabolism
    100072686 (HKDC1)
   00052 Galactose metabolism
    100072686 (HKDC1)
   00500 Starch and sucrose metabolism
    100072686 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100072686 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100072686 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100072686 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100072686 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100072686 (HKDC1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100072686 (HKDC1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100072686 (HKDC1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100072686 (HKDC1)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100072686 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 916 aa AA seqDB search
MFAVHLMAFYFTKLKEDQIKKVDRFLYHMRLSDETLLDIMARFQAEMQKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSEEGKRNVQMESQFYPTPNEIIR
GNGIELFEYVADCLADFMNTKGLKHKRLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSCLTRAMKRHKDINVDTLALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILTDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLVRLRTTVGMDGTLYKIH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSAKGAAMVTAVASRVQAQRKQIDKVLALFRLT
QEQLVGVQDKMRAELEYGLKRDTHSLATVKMLPTYVCGMPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFT
FSFPCRQASIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNLCYMEEMRNIELVEGDEGKMCINTEWGGFGDNGCIDDI
RTQYDKEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLERLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAWKN
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtacacttgatggcattttacttcaccaagctgaaggaggatcagatcaag
aaggtggacagattcctgtatcacatgcggctctccgatgagacccttttggacatcatg
gctcggttccaggctgaaatgcagaaggggctggggaaggacaccaaccccacagcctca
gtgaagatgctgcccacctttgtcagggccattccagatggctcagaaaatggggagttt
ctttccctggatcttggaggatccaagtttcgagtcttgaaggtgcaagtctctgaagag
gggaaacgaaacgtccagatggaaagtcagttctacccaacacccaatgaaattatccga
gggaatggcatcgagctgtttgagtacgtagctgactgtctggcagacttcatgaacacc
aaaggattgaagcataagaggttgcccctcggcctaaccttttcttttccctgcaggcag
actaaactggaagagggtgtcctgctttcatggacgaagaagtttaaggcacggggagtt
caggacacagatgtagtgagctgtctgaccagggctatgaaaagacacaaggacatcaat
gtggacaccctggccttggtcaatgacaccgtggggaccatgatgacgtgcgcctatgac
gatccctactgcgaagttggtgtcatcattggcactggcaccaacgcgtgctacatggag
gacatgagcaacatagacctggtggaaggtgacgagggcaggatgtgcatcaacacggag
tggggggcctttggggacgatggggccctggaagacatccgcaccgagttcgaccgggag
ttggacctcggctctctcaaccccgggaagcaactgtttgagaagatgatcagtggcctg
tacctgggcgaactcgtcaggctcatcttgctgaagatggccaaggcaggcctcttgttt
ggtggtgagaaatcctctgctctccacactaagggcaagattgaaacacggcacgtggct
gccatggaaaagtataaagaaggccttgccaatacaagagagatcctgacggatctgggc
cttgagccttcggaggccgactgcattgcggtccagcacgtctgcaccatcgtctccttc
cgctcagccaatctctgtgcagcggccctggcagccatcctgacgcgcctccgggagaac
aagaagctggtgcggctccggaccacggtgggcatggacggcacactgtacaagatacac
cctcaatacccgaaacgcctgcacaaggtggtgaggagactggtcccgaattgtgacgtc
cgcttcctcctgtcagagagtggcagcgccaagggggctgccatggtgacagcggtggcc
tcccgagtgcaggctcagcggaagcagattgacaaggtgctggctttgtttcggctgacg
caagagcagcttgtgggtgtgcaggacaagatgcgggctgagctcgagtatgggctgaag
agggacacccactccctggccacagtcaagatgctgcccacctatgtctgtgggatgccg
gatggcacagagaaaggaaagttccttgccctggatctggggggaaccaacttccgggtc
ctcctggtgaagatcagaagcggacggaggtcggtgcgaatgtacaataagatcttcgcc
atccccctggagattatgcagggcaccggcgaggagctctttgaccacattgtgcagtgc
atcgcggacttcctggactacatgggcctcaagggagcccagctgcctttgggcttcacc
ttctcgtttccctgcaggcaggcgagcattgacaagggaacactcattgggtggaccaaa
ggcttcaaggccactgactgtgaaggagaagatgtagtggacatgctcagggaagctatc
aagaggagaaatgaatttgacctggacatagttgcagtcgtgaatgacacagtggggacc
atgatgacctgtggctatgaagatcctaattgtgagattggcctgattgcgggaacaggc
agcaacctatgctacatggaggagatgaggaacatcgaactggtagaaggggacgaaggg
aagatgtgcattaacacagagtggggaggatttggagataatggctgtatagacgacatc
cggacccaatatgacaaggaggtggacgaggggtccttgaatcctggcaaacagagatac
gagaaaatgaccagtgggatgtatctgggagagatcgtgcggcagatcctgattgacctg
accaagcagggtctcctcttccgtgggcagatttcagagcgtctccgaaccaggggcatc
tttgaaaccaagttcctgtcgcagatcgaaagtgatcggctggccctcctccaggtcagg
aggatcctgcagcagctcggcctggacagcacgtgtgaggacagcatcgtggtgaaggag
gtgtgcggagctgtgtcccggcgggcggcccagctctgtggcgctggcttggccgccatt
gtagagaaaaggagggaagaccaggggctcgagcgcctgaggatcaccgtgggcgtggat
ggcaccctgtacaagctgcacccgcacttttctcggatattgcaggaaactgtgaaagaa
ctagcccctcgatgtgatgtgacattcatgctgtcagaagatggaagtggaaagggagca
gctctgatcactgctgtggccaagagattacagcaggcatggaagaactag

DBGET integrated database retrieval system