KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_4366Help
Entry
E2348C_4366       CDS       T00796                                 

Gene name
alr
Definition
(GenBank) alanine racemase 1, PLP-binding, biosynthetic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00473  D-Alanine metabolism
ecg01100  Metabolic pathways
ecg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    E2348C_4366 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    E2348C_4366 (alr)
Enzymes [BR:ecg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     E2348C_4366 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ecg01011]
 Precursor biosynthesis
  Racemase
   E2348C_4366 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CAS11914
UniProt: B7UPL1
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4598582..4599661
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgttgtgattaaccgccgcgctctgcgacacaacctgcaacgtctt
cgtgaactggcgcctgccagtaaaatggttgcggtggtgaaagcgaacgcttatggtcac
ggtcttcttgagaccgcgcgaacgctccccgatgctgacgcctttggcgtagcccgtctc
gaagaagctctgcgactgcgtgcggggggaatcaccaaacctgtacttttactcgaaggc
ttttttgatgccagagatctaccgacgatttctgcgcaacattttcataccgccgtgcat
aacgaagaacagctggctgcgctggaagaggctagcctggacgagccggttaccgtctgg
atgaaactcgataccggtatgcaccgtctgggcgtaaggccggaacaggctgaggcgttt
tatcatcgtctgacccagtgcaaaaacgttcgtcagccggtgaatatcgtcagccatttt
gcgcgcgcggatgaaccaaaatgcggcgcaaccgagaagcaactcgctatctttaatacc
ttttgcgaaggcaaacctggtcaacgttccattgccgcgtcgggtggcattttactctgg
ccacagtcgcattttgactgggtgcgcccgggcatcattctttacggcgtatctccgctg
gaagatcgctccaccggtgccgattttggctgtcagccagtgatgtcgctaacctccagc
ctgattgccgtgcgtgagcataaagccggagagcctgtcggttatggtggaacctgggta
agcgaacgtgatactcgtcttggcgtagtcgcgatgggctatggcgatggttatccgcgc
gccgcgccgtccggtacgccagtgctggtgaacggtcgcgaagtgccgattgtcgggcga
gtcgcgatggatatgatctgcgtagacttaggtccacaggcgcaggacaaagccggggac
ccggtcattttatggggcgaaggtttgcccgtagaacgtatcgctgaaatgacgaaagta
agcgcttacgaacttattacgcgcctgacttcaagagtcgcgatgaaatacgtggattaa

DBGET integrated database retrieval system