KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C1707Help
Entry
UTI89_C1707       CDS       T00338                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00250  Alanine, aspartate and glutamate metabolism
eci00410  beta-Alanine metabolism
eci00430  Taurine and hypotaurine metabolism
eci00650  Butanoate metabolism
eci01100  Metabolic pathways
eci01110  Biosynthesis of secondary metabolites
eci01120  Microbial metabolism in diverse environments
eci02024  Quorum sensing
Module
eci_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    UTI89_C1707 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UTI89_C1707 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UTI89_C1707 (gadB)
   00430 Taurine and hypotaurine metabolism
    UTI89_C1707 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    UTI89_C1707 (gadB)
Enzymes [BR:eci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UTI89_C1707 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 PRTase_3
Motif
Other DBs
NCBI-ProteinID: ABE07185
UniProt: Q1RBS9
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1630264..1631733)
Genome map
AA seq 489 aa AA seqDB search
MHLLTLSINPTFLMRSNHFKEFKMDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEM
RDDVAFQIINDELYLDGNARQNLATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAID
LRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNL
VCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNY
EFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKF
GLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGRE
GYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSE
RLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGI
AQQNSFKHT
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgcacttgcttactttatcgataaatcctacttttttaatgcgatccaatcattttaag
gagtttaaaatggataagaagcaagtaacggatttaaggtcggaactactcgattcacgt
tttggtgcgaagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatg
cgtgatgatgtcgcattccagattatcaatgatgaattatatcttgatggcaacgctcgt
cagaacctggccactttctgccagacctgggacgacgataatgtccataagttgatggat
ttatccattaacaaaaactggatcgacaaagaagaatatccgcaatctgcagcaatcgat
ctgcgttgcgtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcag
gccgttggcaccaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatg
aaatggcgttggcgcaagcgtatggaagctgcaggtaagccgactaacaaaccgaacctg
gtgtgcggtccggtacaaatctgctggcataaattcgcccgctactgggatgtggagttg
cgtgagatccctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcc
tgcgacgaaaacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactat
gagttcccgcagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgac
atcgacatgcacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggat
atcgtctgggacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattc
ggtctggctccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcag
gaactggtgttcaacgttgactacctcggcggtcagattggtactttcgccatcaacttc
tcccgcccggcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaa
ggctataccaaagtacagaacgcttcctaccaggttgctgcttatctggcggatgaaatc
gccaaactggggccgtatgagttcatctgtaccggtcgcccggacgaaggcatcccggcg
gtttgcttcaaactgaaagatggtgaagatccgggatacaccctgtatgacctctctgaa
cgtctgcgtctgcgcggctggcaggttccggccttcactctcggcggtgaagccaccgac
atcgtggtgatgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttg
ctggaagactacaaagcctccctgaaatatctcagcgaccacccgaaactgcagggtatt
gcccagcagaacagctttaaacacacctga

DBGET integrated database retrieval system