KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C3017Help
Entry
UTI89_C3017       CDS       T00338                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UTI89_C3017 (gabT)
   00650 Butanoate metabolism
    UTI89_C3017 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UTI89_C3017 (gabT)
   00280 Valine, leucine and isoleucine degradation
    UTI89_C3017 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UTI89_C3017 (gabT)
Enzymes [BR:eci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     UTI89_C3017 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     UTI89_C3017 (gabT)
Amino acid related enzymes [BR:eci01007]
 Aminotransferase (transaminase)
  Class III
   UTI89_C3017 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2947588..2948874
Genome map
AA seq 428 aa AA seqDB search
MRMSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHL
HPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENA
VKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGI
SEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIA
DEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTY
AGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHTEIGDVRGLGAMIAIE
LFEDGDHSKPDAKLTAEIVARARDKGLILLSCGPYNNVLRILVPLTIEDAQIRQGLEIIS
QCFAEAKQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggc
gttgggcaaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgtt
gaaggccgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctg
catccgaaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttc
caggtgctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccg
ggcgattttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcg
gtgaaaatcgcccgcgccgccactaaacgtagcggtactatcgcctttagcggtgcgtat
cacgggcgcacgcattacacactggcgctgaccggcaaggtgaatccatactctgcgggc
atggggctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcata
agcgaggatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaa
gatatcgccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacg
ccagcctttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgcc
gatgaagtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggc
gtggcaccagatctcaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggc
gtcaccgggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctat
gccggtaacccgattgcctgcgtagcggcgctggaagtgttaaaagtgtttgagcaggaa
aatctgctgcaaaaagccaacgatctggggcagaaactgaaagacggattgctggcgata
gccgaaaaacatactgagatcggcgacgtacgcgggctgggagcgatgattgccatcgag
ctgtttgaagatggcgatcacagcaaaccggacgccaaactcaccgccgagatcgtggcg
cgtgcccgcgataaaggcctgattcttctctcctgcggcccgtataacaacgtgctgcgc
atccttgtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagc
cagtgttttgctgaggcgaagcagtag

DBGET integrated database retrieval system